(data stored in ACNUC7421 zone)

EMBL: CP000462.PE184

CP000462.PE184       Location/Qualifiers
FT   CDS_pept        complement(213909..214448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0197"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36216"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER5"
FT                   /protein_id="ABK36216.1"
FT                   /translation="MDLRLRPYKGKRPQLGKRVYVDPCATLVGDIQLGDDASIWPMVAA
FT                   RGDVNHICIGARSNIQDGTVLHLTRKSASNPGGYPLLIGEDVTVGHKAMLHGCTIGNRV
FT                   LVGMGAILLDGVIVEDDVMIGAGSLVPPGKRLEAGFLYMGNPVQQARTLKPAEIAFLKT
FT                   SADNYVLLKDEYLQEA"
     atggacttgc gactgagacc ttacaaagga aaacgcccgc agttgggcaa acgggtatat        60
     gtggacccct gcgccaccct ggtgggggat atccagctgg gtgacgatgc cagcatctgg       120
     cccatggtgg cggcgcgggg ggatgtgaac catatctgca tcggtgcgcg cagcaatatt       180
     caggacggca ccgtattgca cctgacccgc aagagcgcca gcaaccccgg cggctatcca       240
     ctgctgatcg gcgaggatgt cacggtcggt cataaagcca tgcttcacgg ttgcaccatc       300
     ggcaaccggg tgctggtcgg catgggtgcc atcctgctgg atggggtgat cgttgaagac       360
     gatgtgatga tcggggcggg cagcctggtg ccgccaggca agcggctcga ggccggcttt       420
     ctttatatgg gcaatccggt ccagcaggcc cgtaccctca agccagccga gatcgccttc       480
     ctcaagacct cagccgacaa ctatgtactg ctcaaggacg agtatctgca agaagcctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page