(data stored in ACNUC7421 zone)

EMBL: CP000462.PE185

CP000462.PE185       Location/Qualifiers
FT   CDS_pept        220520..221485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0204"
FT                   /product="HTH-type transcriptional regulator EbgR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35993"
FT                   /db_xref="GOA:A0KER6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER6"
FT                   /protein_id="ABK35993.1"
FT                   /translation="MATLKEIALEAGVSQATVSRVLNEDPTLSVKEETKQKIFEIAERL
FT                   EYKTSGARKGVHKSKLHFLAVYAYPQSTEVNDPYYLAIRYGIETQCARLNIELTHFYNG
FT                   AEGRDLSAVDGILVIGHLPAERLAALHSLSAQLVFVDCRSQGDFDSIDVDLALISQQVV
FT                   DFFIAQGHQRIGYIGGQDDGPDLRELAFLDYGQRLGVVQESDLYRGDFSSASGYKLAKE
FT                   MLAGDWPRALFVASDSIAIGVLRAIHEKGIAIPQQIELISVNDIPTAKFTFPPLSTVRI
FT                   HSELMGSQGVNLLVERLRDERDVPLRVLVPSKLTLRGTTR"
     atggccacgt tgaaggaaat tgcactggag gcgggggtct cccaggctac cgtgtcgcgg        60
     gtgctcaatg aagatccgac gctgagcgtc aaggaagaga ccaagcagaa gatcttcgag       120
     atcgccgaac ggctggagta caagaccagc ggtgcccgca agggagttca caagagcaag       180
     ctgcacttcc tggcggtcta tgcctacccg cagagcaccg aggtcaacga tccctattat       240
     ctagccatcc gctatggcat cgagacccag tgtgcccgtc tcaacatcga gctgacccac       300
     ttctacaacg gtgccgaggg gcgcgatctc tccgcggtcg acggtatcct ggtcatcggt       360
     catctgcctg cagagcgtct cgccgcgctc cactccctct ctgcccagct ggtgttcgtg       420
     gattgccgtt ctcaggggga ctttgactcg attgacgtgg atctggcgct gatcagccag       480
     caggtagtgg acttcttcat cgcccaggga caccagcgca tcggctatat cggcggccag       540
     gatgatggcc cggatctgcg cgagctagct ttcctcgact atggtcagcg ccttggtgtg       600
     gtgcaggaga gcgacctcta tcgcggggat ttctccagcg cctccggcta caagttggcc       660
     aaagagatgc tggctggaga ttggcccagg gcgctgttcg tcgcctccga ctccatcgcc       720
     atcggtgtgt tgcgtgccat ccatgagaag ggaatagcga ttccccaaca gattgagctt       780
     atcagcgtca acgatattcc gaccgccaag ttcaccttcc cgccgctctc cacggtgcgg       840
     atccactccg agttgatggg ctcccagggg gtcaatctgc tggttgagcg gctgcgggac       900
     gagcgggatg tcccgctgcg ggtgctggta ccgagtaagt tgaccctgcg tggtactacg       960
     cgctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page