(data stored in ACNUC7421 zone)

EMBL: CP000462.PE186

CP000462.PE186       Location/Qualifiers
FT   CDS_pept        221807..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0205"
FT                   /product="evolved beta-galactosidase alpha-subunit"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837; match to protein family HMM PF02929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37231"
FT                   /db_xref="GOA:A0KER7"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER7"
FT                   /protein_id="ABK37231.1"
FT                   /translation="MNNWENVQFVGENRLAPRAYFFSYADHALAATMQRELSRRFLSLS
FT                   GQWQFHYFDHPLQVPEAFYHSPMSEWDQITVPNMWQMEGHGQLQYTDEGFPFPIDVPFV
FT                   PTNNPTGAYQRSFTLSQAWDGEQVIIKFDGVETYFEVYVNGHYIGFSKGSRLTAEFDIS
FT                   AYAKVGENLLSVRVMQWADSTYIEDQDMWWMAGIFRDVYLVGKPAAHVQDFFIRTALAD
FT                   DNQSATLSCDIQLENLGAAARDHRLVWSLLDQGSEIASGSLDHLAIDGKCDCRFTLDLA
FT                   NPHLWSAEDPYLYQLQLSLYNGQGELLEVIPQRVGVREIKVKDGLFYVNGHYLKLHGVN
FT                   RHDNDHLKSRAVGMDRVERDIVLMKQHNLNSVRTAHYPNDPRFYELCDQYGLFVMAETD
FT                   VETHGFANVGDLSRITDDPFWEPVFVDRIERHVHAQKNHPSIIIWSLGNESGYGCNIRA
FT                   MYRRCKQMDPTRLVHYEEDRDAEVVDLVSTMYSRVSQMNCFGEFPMPKPRILCEYAHAM
FT                   GNGPGGLSEYQQVFDRHPHIQGHYIWEWCDHGILDQDEQGRPVYKYGGDYGDYPNNYNF
FT                   CMDGLIYPDQTPGPGLREYKQVICPVKVRALDLASGKLEVENRYWFSNLDDIRLLVEVK
FT                   AEGELLASQQIRLEGVAPGATTELQLELPSLDGRETFVQLRVIKATATRYSAAEHELGQ
FT                   YQFQLKESTRQLQPFANPNATALQIADERLALTLSGSGFALRFSRLDGKLVSWQQDGNE
FT                   LIERAPRLTFFKPMIDNHKQEYESLWHPNHLQIMQEHFRTLSWRQLGEVVEVTVESLIA
FT                   PPVFDFGMRCRYVYTLSPNGQLHVALSGQPYGGYDDIIPKIGFELGIRQDLDRVHYYGM
FT                   GPGENYQDSRQSNWIDSFQSTVGEMWEHYPFPQDNGNRQQVRWATLTNRHGAGLYVRPD
FT                   APINLSVWPYSWEHIHAAQHINELEPSGYLTLNLDHKVLGLGSNSWGSEVLDSWRVRFE
FT                   PFSFGLTLLPIARGNLNPAALAGLDLTINGGRNLA"
     gtgaataact gggaaaacgt ccaattcgtt ggtgaaaaca ggctggctcc gcgtgcctac        60
     ttcttctctt atgccgacca tgcgctggcg gccaccatgc agcgcgaact gagccgccgt       120
     tttttgagcc ttagcggcca gtggcagttc cactacttcg accatcccct gcaggtgccg       180
     gaggccttct atcacagccc catgagcgag tgggaccaga tcaccgtgcc caacatgtgg       240
     cagatggaag ggcatgggca gctgcagtac accgacgaag gttttccctt ccccatcgat       300
     gtgcccttcg tgccgaccaa caaccccacc ggcgcctatc agcgcagctt cacgctgagc       360
     caggcctggg acggcgagca ggtgatcatc aagtttgacg gggtggagac ctactttgag       420
     gtctatgtga acggccacta catcggcttc agcaagggca gccgtctcac cgccgagttc       480
     gatatcagtg cctacgccaa ggttggcgag aacctgctgt cggtgcgggt gatgcagtgg       540
     gcggactcca cttatatcga agatcaggat atgtggtgga tggcggggat cttccgcgac       600
     gtctatctgg tgggcaaacc ggccgcccat gtgcaggact tcttcatccg caccgcgctg       660
     gccgatgaca accagagcgc cacccttagc tgcgatatcc agctcgagaa cctgggtgca       720
     gctgcccgtg atcaccgtct ggtctggtcg ctgctggatc agggcagcga gatcgccagc       780
     ggctcgctcg accatctcgc catcgacggc aagtgtgatt gtcgcttcac gctggatctg       840
     gccaaccccc atctgtggag cgccgaagat ccttacctct accagctgca actctccctc       900
     tacaacggac agggcgagct gctggaagtg atcccgcagc gggtcggggt gcgtgaaatc       960
     aaggtcaagg atggcctctt ctacgtcaac ggccactacc tcaagctgca cggggtgaac      1020
     cgtcacgaca acgaccacct caagagccgt gcggtcggca tggatcgggt ggaacgcgat      1080
     atcgtgctga tgaagcagca caacctcaac tcggtgcgca ctgcccacta cccgaacgac      1140
     ccgcgcttct atgagctgtg cgatcagtac ggcctgttcg tgatggcgga gacagacgtg      1200
     gagacccacg gttttgccaa cgtcggcgat ctcagccgca tcacagacga tcccttctgg      1260
     gagccggtgt tcgtggatcg catcgagcgc catgttcacg cccagaagaa ccacccctcc      1320
     atcatcatct ggtcgctggg caacgagtcc ggctacggct gcaacatcag ggccatgtac      1380
     cgccgctgca agcagatgga tccgacccga ctggtgcact acgaggaaga ccgcgatgcc      1440
     gaggtggtgg atctggtcag caccatgtat tcgcgcgtct cccagatgaa ctgcttcggc      1500
     gagttcccta tgcctaagcc gcgcatcctc tgcgaatacg cccacgccat gggcaacggc      1560
     ccgggtggcc tcagcgaata tcagcaggtg ttcgaccgtc atccccacat tcagggtcac      1620
     tacatctggg agtggtgcga tcacggcatt ctggatcagg acgagcaggg ccgcccggtc      1680
     tacaagtacg gtggcgacta cggcgactac cccaacaact acaacttctg catggatggc      1740
     ctcatctatc ctgatcagac ccctgggccg ggcctgcgcg aatacaagca ggtgatctgc      1800
     ccggtcaagg tgcgcgcgct ggatctggcc agcggcaagc tggaagtgga aaaccgttac      1860
     tggttctcca atctcgacga catccgtctg ctggtcgaag tgaaggccga gggcgaactg      1920
     ctggccagcc agcagatccg gctggaaggg gtggctcccg gtgccaccac cgagctgcaa      1980
     ctcgaactgc catccctcga tgggcgggaa accttcgtcc agctgcgggt catcaaggcc      2040
     actgccaccc gctacagcgc ggcggagcac gagctgggcc agtaccagtt ccagctgaaa      2100
     gagtcgactc gccagctgca gccctttgcc aaccccaatg ccacggcgtt gcagattgcc      2160
     gatgagcggc ttgcgctgac cttgagcggc agcggcttcg ccctgcgctt ctcgcgcctc      2220
     gacggcaagc tggtgagctg gcagcaggat ggcaatgagc ttatcgagcg ggcgccgcgc      2280
     ctcaccttct tcaagccgat gatcgacaac cacaagcagg agtacgagag cctgtggcac      2340
     ccgaaccacc tgcagatcat gcaggagcac ttccgcactc tgagctggcg tcagctgggt      2400
     gaggtggtcg aggtgacggt ggagagcctg atcgcgccgc cggtgttcga cttcggcatg      2460
     cgctgccgct acgtctacac cctgagcccg aacggccagc tgcacgtggc actgtccggt      2520
     cagccctacg gcggctatga cgacatcatt cccaagatcg gcttcgagct gggtattcgt      2580
     caggatctcg accgggtgca ctactacggc atggggccgg gcgagaacta tcaggacagc      2640
     cgccagagca actggatcga cagcttccag agcacagtcg gcgagatgtg ggagcactac      2700
     cccttcccgc aggacaacgg caaccgccag caggtgcgct gggcgaccct gaccaatcgc      2760
     cacggcgccg gtctctacgt gcggcccgat gcccccatca acctgagcgt ctggccctac      2820
     agctgggagc acatccacgc ggcgcagcac atcaacgagc tggagccgag tggttatctc      2880
     accctcaatc tggatcacaa ggtactgggg ctgggctcca actcctgggg ttccgaggtg      2940
     ctggactcct ggcgggtgcg cttcgagccg ttcagcttcg gcctgaccct gctgcccatc      3000
     gcccgtggca acctcaatcc ggctgcgctg gccgggctcg atctcaccat caacggcggg      3060
     aggaacctcg catga                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page