(data stored in ACNUC7421 zone)

EMBL: CP000462.PE187

CP000462.PE187       Location/Qualifiers
FT   CDS_pept        224494..225333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0206"
FT                   /product="evolved beta-D-galactosidase, beta subunit;
FT                   cryptic gene"
FT                   /note="identified by match to protein family HMM PF04074"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36897"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER8"
FT                   /protein_id="ABK36897.1"
FT                   /translation="MGALPLPAGQRQPPAGALGDPDQSPRRRSLRAARCPHQPERLALQ
FT                   LGAHPRGAAHQRAGAEWLSHPQSGSQGTGAGLQLLGFRGAGLLAGALRAVQLRPDPAAH
FT                   RPWQPQSGCAGRARSHHQRREEPRMITLDNLTLFKNIYREGKKWGRCVEAINNLANLKP
FT                   GICHSIGDSLTYRLQEGASPATSLFEGQRRYFDVHYYLEGEETVEWAAKSDLRVEQGYD
FT                   DTTDREWLVGEVRERQQVGNGQVVIFENDEAYRFVGDAPVRKLIIKVTVEGGYFKNK"
     gtgggagcac taccccttcc cgcaggacaa cggcaaccgc cagcaggtgc gctgggcgac        60
     cctgaccaat cgccacggcg ccggtctcta cgtgcggccc gatgccccca tcaacctgag       120
     cgtctggccc tacagctggg agcacatcca cgcggcgcag cacatcaacg agctggagcc       180
     gagtggttat ctcaccctca atctggatca caaggtactg gggctgggct ccaactcctg       240
     gggttccgag gtgctggact cctggcgggt gcgcttcgag ccgttcagct tcggcctgac       300
     cctgctgccc atcgcccgtg gcaacctcaa tccggctgcg ctggccgggc tcgatctcac       360
     catcaacggc gggaggaacc tcgcatgatc accctggaca acctgaccct gttcaaaaac       420
     atctaccggg agggcaagaa gtggggccgc tgcgtggagg ccatcaacaa cctggccaac       480
     ctcaagcccg gcatctgcca ctccatcggc gactccctca cctatcgctt gcaggagggg       540
     gccagcccgg ccacctcatt gttcgagggg cagcgccgct acttcgacgt tcactactac       600
     ctggaagggg aagagacggt ggagtgggct gccaagtcgg acctgcgggt cgagcagggc       660
     tatgacgaca ccacagaccg cgagtggctg gtcggtgagg tgcgtgagcg ccagcaggtg       720
     ggtaacgggc aggtggtgat cttcgagaac gacgaggcct accgattcgt cggtgatgcg       780
     ccggtacgca agctgatcat caaggtcacc gtcgaaggcg gctacttcaa gaacaaataa       840
//

If you have problems or comments...

PBIL Back to PBIL home page