(data stored in ACNUC7421 zone)

EMBL: CP000462.PE190

CP000462.PE190       Location/Qualifiers
FT   CDS_pept        227463..228899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0209"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39498"
FT                   /db_xref="GOA:A0KES1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES1"
FT                   /protein_id="ABK39498.1"
FT                   /translation="MSESVRGTIGKFALLSMTFAAVFNVRNIVNNNIELGLSSAPIFLL
FT                   ATLVYFIPFVFIIAEFVSANKNSESGMYDWLKKPLGTRMAYLGSFLYWFVNLFWFVSLL
FT                   PNVIAYASYAMLGYEYSFSPMVTSVISIVLFAAATHISTKGASWLGKIAEIVAYGVFAL
FT                   FAIYVLGALMALSGDHVPAQPITLEAMTPTVNWATLGIMCWIFQAAGGAETAAAYLNDV
FT                   KGGQKSFIKVIISAGIVIGAMYAVGSLLVNVFVPRESLTYAGGMVEIFTGMAQYFQLSE
FT                   ALVGRFVGVVLFIAMFGSMMMWTSAPVKIHFSEIPQGVYGEKTTQLNEHGVPVRAAWWQ
FT                   FAFVFVMLVVNGFGSESVQQMMNTAINLTAGTAMLPPIFIMVAYFVFRWKHDDTPREFR
FT                   MGSRTFGMGVVSVLIAIFVVSMSASAFPSGVDLVRAFFINVFMTAVFSALAYWWISRFE
FT                   KRQARKQATGTAGGKLAKQS"
     atgtctgaat ccgtacgcgg caccataggc aagtttgccc tgttgtcgat gacctttgcc        60
     gccgtgttca acgtgcgcaa catcgtcaac aacaacatcg agctggggct cagctccgcc       120
     cccatcttcc tgctggcgac cctggtctac ttcatcccgt tcgtcttcat catcgccgag       180
     ttcgtctcgg ccaacaaaaa ctccgagtcg ggcatgtacg actggctgaa aaagccgctc       240
     ggcacccgga tggcctatct gggctcgttt ctctactggt tcgtgaacct gttctggttc       300
     gtctccctgc tgcccaacgt catcgcctac gcctcctacg ccatgctggg gtacgagtac       360
     agcttctcgc ccatggtcac ctcggtcatc tccatcgtgc tgtttgcggc ggcgacccac       420
     atctccacca agggggcgag ctggctcggc aagattgccg agatcgtggc ctacggggtg       480
     tttgccctgt tcgccatcta tgtgctgggc gccctgatgg ccctgagtgg cgatcatgtg       540
     ccggcccagc ccatcaccct ggaagccatg actcccaccg tcaactgggc gacgctcggc       600
     atcatgtgct ggatcttcca ggcggcgggc ggtgctgaga cggcggcggc ctacctcaat       660
     gacgtgaagg ggggccagaa gtccttcatc aaggtgatca tcagcgccgg catcgtcatc       720
     ggtgccatgt atgcggtcgg ttccctgctg gtgaacgtgt tcgtgccgcg cgagagcctc       780
     acctatgccg gcggcatggt ggagatcttc accggcatgg cccagtactt ccagctgtcg       840
     gaagcactgg tgggccgctt cgtcggcgtg gtgctgttca tcgccatgtt cggctccatg       900
     atgatgtgga cctcggcgcc ggtgaagatc cacttctccg agatcccgca gggtgtctac       960
     ggcgagaaga ccacccagct caacgagcac ggcgtgccgg tacgcgccgc ctggtggcag      1020
     ttcgccttcg tgttcgtgat gctggtggtc aacggcttcg gctcggaatc cgtgcagcag      1080
     atgatgaaca ccgccatcaa cctcaccgcc ggtaccgcca tgctgccgcc gatcttcatc      1140
     atggtggcct acttcgtgtt ccgctggaaa cacgacgaca ccccgcgcga gttccgcatg      1200
     ggatcgcgca ccttcgggat gggggtggtg tcggtgctga tcgccatctt cgtggtgagc      1260
     atgagcgcct ccgccttccc gagcggggtg gatctggtgc gcgccttctt catcaacgtc      1320
     ttcatgaccg cggtcttctc ggcgctggcc tactggtgga tctcccgctt cgagaagcgc      1380
     caagcccgca agcaggccac cggcacagcc ggcggcaagc tggccaagca gagttga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page