(data stored in ACNUC7421 zone)

EMBL: CP000462.PE193

CP000462.PE193       Location/Qualifiers
FT   CDS_pept        232655..233377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36335"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES4"
FT                   /protein_id="ABK36335.1"
FT                   /translation="MKWMMGVVLAVGLSGCSWLDDTRVSGAGAVIEQQHGVGRQVTRVL
FT                   AGVPASVHLVAGEPRGLRIRGQENLLPYLVLSERGDKLEIEVKDGYRLDPTEPLEITIT
FT                   LPALHELALAGVANGELRGFKGEALVLSVAGVGDIVADGLELDRLEGNIAGAGSLDLGN
FT                   STARAVELNIAGSGDVLGAELKGREVEVNIAGSGDVEVRAQERLKVGIAGSGSVSYWGD
FT                   PVLQSEIAGSGEVSRQGS"
     atgaaatgga tgatgggcgt ggtgctggcg gtcgggctca gcgggtgcag ctggctggat        60
     gatacccggg tgagcggggc tggggccgtg atcgagcagc agcacggggt gggccggcag       120
     gtgacccggg tgctggccgg ggtgcctgcc agcgtccatc tggtggccgg cgagccgcgc       180
     ggattgcgca tccgcgggca ggagaacctg ttgccctacc tggtgctgag cgagcggggc       240
     gacaagctgg agatcgaggt gaaggacggc taccggctcg atccgaccga gccgctggag       300
     atcaccatca ccctgcccgc gctccatgag ctggcgctgg caggggttgc caacggtgag       360
     ctgcgcggct tcaaggggga ggcgctggtg ctgtcggtgg ccggggtcgg tgacatcgtc       420
     gccgacgggc tcgaactgga tcggctggag ggcaacatcg cgggcgcagg cagcctggat       480
     ctggggaaca gcacggccag ggcggtcgag ctcaacatcg ccggctcggg ggatgtgctg       540
     ggggccgagc tgaaggggcg cgaggtggag gtcaatatcg ccggcagcgg cgacgtggag       600
     gttcgggccc aggagcggct caaggtgggc atcgccggct cgggctcggt cagctattgg       660
     ggcgatcccg tgctgcagag cgagatcgcc ggctccggcg aggtgagccg gcagggcagc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page