(data stored in ACNUC7421 zone)

EMBL: CP000462.PE194

CP000462.PE194       Location/Qualifiers
FT   CDS_pept        complement(233431..234267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0213"
FT                   /product="esterase YeiG"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00756;
FT                   match to protein family HMM TIGR02821"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38973"
FT                   /db_xref="GOA:A0KES5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES5"
FT                   /protein_id="ABK38973.1"
FT                   /translation="MNLDIISSNKSFGGWHKRYSHASEVLGCEMRFAIYLPPQALTGQK
FT                   VPVLYWLSGLTCTDENFMQKAGAQRIAAELGIALVAPDTSPRGEDVADDPGYDLGMGAG
FT                   FYVNATQHPWRDHYQMYDYVTRELPELIETHFPVSTKRAISGHSMGGHGALIAALREPG
FT                   RYRSVSAFSPISHPSRCPWGQKALGAYLGNNPLLWQEWDACQLLRHHPVTPLPTLVDVG
FT                   LDDPFLAEQLHIDALADAAAGKEWPLELNRHAGYDHSYYFVASFIEAHLRFHARHL"
     atgaatctgg acataatcag cagcaacaag agcttcggcg gctggcacaa gcgctacagc        60
     cacgcctccg aggtgctggg ttgcgagatg cgcttcgcca tctatctacc gccccaggcc       120
     ctcaccggcc agaaggtacc cgtgctctac tggctctccg gcctcacctg caccgatgaa       180
     aacttcatgc agaaggcggg cgcccagcgc atcgccgccg aactcggcat cgccctggtg       240
     gcgccggaca ccagcccgcg cggcgaagac gtagcggacg accccggtta cgatctcggc       300
     atgggcgccg gcttctacgt caacgccacc cagcatccct ggcgcgatca ctaccagatg       360
     tacgactacg tcacccgcga gctgcccgag ctcatcgaga cccacttccc ggtctcgacg       420
     aagcgtgcca tcagcggcca ctccatgggt ggccacgggg cgctcatcgc cgccctgcgc       480
     gagccaggtc gctaccgctc ggtgtcggcc ttcagcccca tcagccaccc gagccgctgt       540
     ccctggggcc agaaggcact cggcgcctac ctcggcaaca accccttgct gtggcaggag       600
     tgggacgcct gccagctgtt gcgccaccac ccggtgacgc cgctgccgac tctggtggat       660
     gtagggctgg acgatccctt cctggccgaa cagctgcaca tcgacgccct ggccgatgcg       720
     gccgccggca aggagtggcc gctggagctc aaccgccacg ctgggtacga ccacagctac       780
     tacttcgtgg cgagcttcat cgaggcgcac ctgcgctttc acgcccgcca cctctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page