(data stored in ACNUC7421 zone)

EMBL: CP000462.PE195

CP000462.PE195       Location/Qualifiers
FT   CDS_pept        complement(234317..235444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0214"
FT                   /product="alcohol dehydrogenase class III"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39411"
FT                   /db_xref="GOA:A0KES6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES6"
FT                   /protein_id="ABK39411.1"
FT                   /translation="MAQVQSIKCKAAIAWGPGQPLSIEEVEVMPPQAGEVRVRIVATGV
FT                   CHTDAFTLSGEDPEGVFPCILGHEGGGIVESVGEGVTSVKVGDHVIPLYTPECGECKFC
FT                   KSGKTNLCQKIRATQGKGLMPDGTTRFSKDGQPIYHYMGTSTFSEYTVLPEISIAKVDP
FT                   AAPLEEVCLLGCGVTTGIGAVMNTAKVKEGESVAIFGLGGIGLSAVIGARLAKAGRIIA
FT                   IDINESKFELARKLGATDCINPNDYDKPIQEVIVELTDGGVDFSFECIGNVKVMRAALE
FT                   CCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVRGRSELPSYVQRYMQGE
FT                   FKLDDFITHTMGLEQINEAFDLMHEGKSIRSVIHY"
     atggcacagg ttcaaagcat caagtgtaag gccgccatcg cctggggccc gggccagccc        60
     ctctccatcg aagaagtcga ggtcatgccg ccccaggcgg gcgaagtgcg ggtgcgcata       120
     gtcgcgaccg gcgtctgcca caccgatgcc ttcaccctct ccggtgaaga tccggaaggg       180
     gtcttcccct gcatcctcgg ccacgagggg ggcggcatcg tcgaatccgt cggcgagggc       240
     gtcaccagcg tcaaggtggg cgatcacgtg attccgctct acacccccga gtgcggcgag       300
     tgcaagttct gcaaatccgg caagaccaac ctgtgccaga agatccgcgc cacccagggc       360
     aaggggctga tgccggacgg caccacccgc ttctccaagg atggccagcc catctatcac       420
     tacatgggca cctccacctt cagcgaatac acggtgctgc ccgagatctc catcgccaag       480
     gtggacccgg ccgccccgct ggaagaggtc tgcctgctcg gctgcggcgt caccaccggc       540
     atcggcgccg tgatgaacac agccaaggtg aaagagggtg agagcgtcgc catcttcggg       600
     ctgggcggca tcggcctctc cgcggtgatc ggcgctcgtc tggccaaggc cggccgcatc       660
     atcgccatcg acatcaacga gagcaagttc gaactggccc gcaagctggg cgccaccgac       720
     tgcatcaacc cgaacgacta cgacaagccc atccaggagg tgatcgtcga gctcaccgac       780
     ggcggcgtcg acttctcgtt cgagtgcatc ggcaacgtca aggtgatgcg cgcggcgctg       840
     gagtgctgcc acaagggctg gggcgagtcg gtcatcatcg gcgtggccgg cgctggccag       900
     gagatcagca cccgtccgtt ccagctggtc accggccgag tctggcgcgg cagcgccttc       960
     ggcggcgtgc gcggtcgcag cgagctgccg agctacgtgc agcgctacat gcagggtgaa      1020
     ttcaagctgg acgacttcat cacccacacc atggggcttg agcagatcaa tgaggcgttc      1080
     gatctgatgc acgaaggcaa gagcatccgc agcgtcatcc actactga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page