(data stored in ACNUC7421 zone)

EMBL: CP000462.PE196

CP000462.PE196       Location/Qualifiers
FT   CDS_pept        235564..236469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38080"
FT                   /db_xref="GOA:A0KES7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES7"
FT                   /protein_id="ABK38080.1"
FT                   /translation="MFGWEGICEFVSVAEQGGFTPAARKLGVSVAQVSRQVAQLEDRLQ
FT                   AKLLLRTTRQVRLTELGEIYYRHCRQLLDNLYEAELAVGRHQAVPQGTLRITAPVSYGE
FT                   SRIAPLVNDFMVRFPQLEVTLNLTNQLLDLVHEGYDLALRLGHLKDSSLVARKLAQRVP
FT                   YVCASPAYTARHGMPNSLSELTRHTCLVGNSDEWHFTLDGRPHSVRVHGLLHCNSGHAL
FT                   LDAALKGIGIIQLPDYYVSDHLAQGELIELLPELRAPAEGIWALYPHNRHLSPKVRLLV
FT                   DYLAERLSDPHQPALVRPVG"
     atgttcggct gggaagggat ctgtgagttt gtcagcgtgg cggagcaggg gggctttacc        60
     ccggcggcgc gcaagctggg ggtgtcggtg gcgcaagtca gccggcaggt ggcacagctg       120
     gaggatcggc tgcaggccaa gctgctgctg cgcaccaccc gtcaggtgcg gctcactgag       180
     ctcggcgaga tctactatcg ccactgtcgc cagctgctgg acaacctcta cgaggcggag       240
     ctggcggtgg ggcgtcatca ggcggtgccg cagggcactc tgcgcatcac ggccccggtc       300
     tcctacggcg agagccgcat cgccccgctg gtgaacgact tcatggtgcg ctttccccag       360
     ctggaggtga ccctcaacct gaccaaccag ctgctggatc tggtgcacga gggctacgat       420
     ctggcgctgc ggctcggcca cctcaaggac tccagcctgg tggcacgcaa gctggcgcag       480
     cgggtgccct atgtgtgcgc ctctcccgcc tacaccgccc gccacggcat gcccaacagc       540
     ctctccgagc tcacccgcca cacctgcctg gtgggcaaca gcgacgagtg gcacttcacc       600
     ctggatggcc gcccccacag cgtgcgggtg cacggcctgc tgcactgcaa cagcggccac       660
     gccctgctgg atgcggcgct caaggggatc ggcatcatcc agctgccgga ctactacgtg       720
     agtgaccacc tggcccaagg cgagcttatc gagctgctgc cggagctgcg ggcgccggcg       780
     gaggggatct gggccctcta tccccacaac cgccatctct ctcccaaggt gcggctgctg       840
     gtggactatc tggcggagcg cctgagcgat ccccatcagc ccgcgctggt gcgccctgtc       900
     ggctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page