(data stored in ACNUC7421 zone)

EMBL: CP000462.PE197

CP000462.PE197       Location/Qualifiers
FT   CDS_pept        complement(236526..237491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0216"
FT                   /product="putative transport system permease abc
FT                   transporter protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38576"
FT                   /db_xref="GOA:A0KES8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES8"
FT                   /protein_id="ABK38576.1"
FT                   /translation="MFEILILMLDATIRTAPPLILAAMAGMFCERSGVVNIALEGKLLA
FT                   AAFASAAAAAVSGSAWIGLGAGVGVSILFALMHGFATITHRGDQVVSGMAINILAAGLT
FT                   VTLGRYWFDQGGQTPALSGAARFAPIDLPYAKELYDVPVISQLYSELLSGHSLLEYVAF
FT                   AAVPLAWWVLFRTRFGLRLRAVGEAPAAVDTAGISVVRMRYTALIIGGLLAGIGGTYLA
FT                   VAQTAQFIPNMSAGKGFMALAALVFGKWRPWNAMAACLLFGFLDAVAIRLQGVSIGGFP
FT                   IPVQAIEALPYILTVFLLAGFIGKAVAPKALGTPYVKERE"
     atgttcgaaa ttctgatcct gatgctggat gccaccatcc gcaccgcgcc gccactcatt        60
     ctggcggcca tggccggcat gttctgcgag cgctccgggg tggtcaacat cgccctggag       120
     ggcaagctgc tggcggcggc gttcgccagt gcggcggcgg cagccgtctc cggctctgcc       180
     tggattgggc tgggtgccgg ggtgggtgtc tccatcctgt tcgccctgat gcacggcttt       240
     gccaccatca cccaccgtgg tgatcaggtg gtgagcggca tggccatcaa catcctggcg       300
     gccggcctga ccgtcaccct gggccgttac tggttcgatc agggcggtca gaccccggcg       360
     ctgtccggcg cggcccgctt cgcccccatc gacctgccct atgccaagga gctgtatgac       420
     gtgccggtca tcagccagct ctacagcgag ctgctgagcg gccactccct gctggagtac       480
     gtggcgttcg ccgccgtgcc gctggcctgg tgggtgctgt tccgtacccg cttcggcctg       540
     cgcctgcggg cggtgggcga ggcgccggca gcggtcgata ccgccggtat ctcggtggtg       600
     cgcatgcgct acaccgcgct catcatcggc ggcctgctgg ccggtatcgg cggcacctac       660
     ctggcggtgg cccagaccgc ccagttcatc cccaacatga gcgcgggcaa gggcttcatg       720
     gcgctggcgg cgctggtgtt cggcaagtgg cgcccctgga acgccatggc ggcctgcctg       780
     ctgttcggct tcctcgatgc agtcgccatc cggctgcaag gggtcagcat cggcggtttc       840
     ccgatcccgg tacaggccat cgaggcgctg ccctacatcc tgaccgtgtt cctgctggcc       900
     ggcttcatcg gcaaggcggt ggcacccaag gcgctcggca ccccctacgt caaggagcgg       960
     gaatag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page