(data stored in ACNUC7421 zone)

EMBL: CP000462.PE200

CP000462.PE200       Location/Qualifiers
FT   CDS_pept        complement(240356..241459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0219"
FT                   /product="membrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37319"
FT                   /db_xref="GOA:A0KET1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET1"
FT                   /protein_id="ABK37319.1"
FT                   /translation="MISLTHTVAHLQLASVLYGLPRQVVDPHITIKDTIVTKVLKLATV
FT                   AALTLAALSAQAASQPAVIYDTAGKFDKSFNEAVFRNGVEVYNKDKGVKVKEFEPQNEA
FT                   QREQGLRRLASRGNGPIVAVGFNMGSAVEKVATEFPKTQFTIIDMVVDKPNVQSVIFKE
FT                   HEGSFLVGALAAIASKTGKVGFVGGMDIPLIRKFECGYEQGAKYVNPKIEVFQNMTGST
FT                   PAAFADPAKGAELAKSQFAKGADVVYAAAGGTGIGVYQAAKDEGKLAIGVDSNQNHLQP
FT                   GTMLTSMVKSVGLAAYQTWDDAAKGTWKPGIKNLGLAEGGVDWALDKDNEKLITPEMKA
FT                   KVDAIKAEIISGKVKVHDYMSDSTCKY"
     atgatctcct tgacccacac cgtggctcac ttacagttag ccagcgtgct ttatggcctg        60
     ccccggcagg ttgtggaccc tcacataaca atcaaggata cgatcgtgac taaagtgctc       120
     aagctggcca ccgttgccgc cctcactctc gctgcccttt ctgcccaggc agcctcccag       180
     cccgccgtca tctacgacac cgcaggtaaa ttcgacaaat cgttcaacga agccgtgttc       240
     cgcaatggcg tcgaagtcta caacaaagac aaaggcgtca aggtcaagga gttcgaaccc       300
     cagaacgaag cccagcgtga gcagggtctg cgtcgtctgg ccagccgtgg caacggcccg       360
     atcgttgccg tcggcttcaa catgggttcc gcggtagaga aagtagcgac cgagttcccg       420
     aaaacccagt tcaccatcat cgacatggtg gtcgacaagc cgaacgtcca gtccgtcatc       480
     ttcaaggagc atgaaggttc cttcctggtg ggcgcgctgg ctgccatcgc ttccaagacc       540
     ggcaaggtcg gcttcgtggg cggcatggac atcccgctga tccgcaaatt cgagtgcggc       600
     tacgagcagg gtgccaagta cgtcaatccg aagatcgaag tgttccagaa catgaccggc       660
     tccaccccgg cggcgtttgc tgacccggcc aagggtgctg aactggccaa gtcccagttc       720
     gccaagggcg ccgacgtagt ctatgccgcc gctggcggta ccggcatcgg tgtttaccag       780
     gccgccaagg acgaaggcaa gctggccatc ggcgtggatt ccaaccagaa ccacctgcaa       840
     ccgggcacca tgctgacctc catggtcaag tcggttggcc tggccgccta ccagacctgg       900
     gatgacgccg ccaagggcac ctggaaaccg ggtatcaaga acctgggcct ggccgagggt       960
     ggtgtggatt gggcactcga caaagacaac gagaagctga tcacccccga gatgaaagcc      1020
     aaggtggacg ccatcaaggc cgaaatcatc tccggcaagg tcaaggtgca cgactacatg      1080
     agcgacagca cctgcaaata ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page