(data stored in ACNUC7421 zone)

EMBL: CP000462.PE203

CP000462.PE203       Location/Qualifiers
FT   CDS_pept        complement(245611..246813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0222"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39564"
FT                   /db_xref="GOA:A0KET4"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET4"
FT                   /protein_id="ABK39564.1"
FT                   /translation="MNVSIGDKLLFPIVSLCYFYFILNLFKWYHMKIKQTDPDIDTIFG
FT                   RIERKYIDLQPDFQRDLVWNTSKKQSLIDTILREWQFPPVFLILVTDGLHEVLDGQQRL
FT                   NAIHEFMTNKLRVNGNIEPFDDNIARLNGLTYEQLPQDVKRRFGLYSMRVCELYDYKED
FT                   EPYELFFRLNQGSVLTPAEKRNTLYGPVREQVRELVHEMDLKGLNIDRIGFNNSRLAYQ
FT                   DVISRFLYALQHRSIEKKITDQMLIDFFRYPTGVDKETYLSAKKTIDKLSSLIHEKVKL
FT                   NKPTLFTWLLFINYEGAIEELFLHMNDLRGKSRSGDIGDPFQLFLIELYQDKSATSVND
FT                   AAPVKIRLLVLYLMGIHIGLNFNSENGLIAHSIYIKIISENNPTESLLLDYMSYSNWGA
FT                   L"
     gtgaacgtat ctatagggga taaattgcta ttcccaatcg tatctctatg ttatttttat        60
     ttcattttaa atttatttaa atggtatcac atgaagataa aacaaacaga tcctgatatt       120
     gacactattt ttggtcgtat agaaagaaaa tatattgatt tacaacctga ttttcagcga       180
     gatcttgttt ggaatacatc taagaaacaa agtttaattg atacgatcct gagagagtgg       240
     caatttccgc cagttttttt aatattggta actgatggtt tacatgaagt tcttgatggg       300
     cagcaaagat taaatgcaat tcatgaattc atgacaaata aattgcgtgt taatggaaat       360
     attgagcctt tcgatgacaa tatagctcgt ctaaatggtt taacttatga gcagttgccg       420
     caggatgtaa agcgacggtt tggcttatat tcaatgcgag tatgtgaact ttatgattat       480
     aaagaagatg aaccatatga gttatttttc cgtctgaacc aaggtagtgt tttaactcca       540
     gcagaaaaac gaaatacact ttatggccca gtgagagagc aagtccgtga acttgtccat       600
     gaaatggacc tgaaaggact gaatatagat cgaattggct ttaacaatag tcggctagct       660
     tatcaggatg tcatctcacg ctttttatat gccctacaac atcgaagcat cgaaaaaaag       720
     attacagacc aaatgttaat tgatttcttt aggtatccaa caggtgttga taaagaaact       780
     tatttaagtg caaaaaaaac catcgataag ctatcctcac tcattcatga aaaggtgaag       840
     ctaaataaac caacactatt cacttggtta cttttcataa attacgaggg tgcgatagaa       900
     gaattattcc tacacatgaa tgatttacgt ggtaaatctc gaagtggtga tataggggat       960
     cctttccagc tttttttaat tgagctctac caagataagt ccgcgacaag tgttaatgat      1020
     gcagcacctg ttaaaataag actcttggtt ttatacctaa tggggattca tattgggtta      1080
     aattttaatt cagaaaatgg attaattgct catagtatat atattaaaat tatttctgaa      1140
     aataatccga cagagagttt actgcttgat tatatgtcat actcgaattg gggggcgcta      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page