(data stored in ACNUC7421 zone)

EMBL: CP000462.PE208

CP000462.PE208       Location/Qualifiers
FT   CDS_pept        250157..250657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37372"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET9"
FT                   /protein_id="ABK37372.1"
FT                   /translation="MNRDIVAQFIKMLTNLDQCLAKAEAHAAAKKFNVENFFGDRLIVD
FT                   MLPFSKQVLICCDSARAVVATASLSEPPVLGDDPKTMADLRAHVAKTLTYLQSKLDADF
FT                   SQYASGHYYPYWAGGKGMDGHTCVHEYGIPNFYFHLTMTYALLRKAGVELGKGDYLGAI
FT                   NLQ"
     atgaatcgtg atatcgtcgc ccagtttatc aagatgctga ccaacctcga ccagtgcctg        60
     gccaaggccg aggcccacgc cgccgccaag aaattcaatg tggagaactt cttcggcgat       120
     cggctgatcg tcgacatgct gccattcagc aagcaggtgc tgatctgctg cgacagcgcc       180
     cgcgccgtgg tggccaccgc cagcctgagc gagccgccgg tgctggggga tgaccccaag       240
     accatggcgg atctgcgcgc ccacgtggcc aagaccctca cctatctgca gagcaagctg       300
     gatgccgatt tcagtcagta tgcgagcggc cactactacc cctactgggc cggtggcaag       360
     gggatggacg gccacacctg cgtgcatgag tacggcattc ccaacttcta cttccacctc       420
     accatgacct atgccctgct gcgcaaggcc ggggtcgagc tcggcaaggg ggattacctg       480
     ggcgccatca acctgcaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page