(data stored in ACNUC7421 zone)

EMBL: CP000462.PE21

CP000462.PE21        Location/Qualifiers
FT   CDS_pept        complement(24187..27267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0021"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38722"
FT                   /db_xref="GOA:A0KR19"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR19"
FT                   /protein_id="ABK38722.1"
FT                   /translation="MRFTDIFIKRPILAISISFLIALLGVQAVFKMQVREYPEMTNTVV
FT                   TVSTSYYGASADLIQGFITQPLEQAIAQADNIDFMTSSTQLGSSTITAYMKLNTNPNAA
FT                   LSDILAKVNSVRSQLPKESEDPSVTMSTGSTTAVLYIGFTSPELNASQITDYLERVIKP
FT                   QLFTVGGVSKVDMYGGTKYALRVWLDPAKMAAFNLTAADVMSVLNSNNYQSATGQATGY
FT                   FTLYNGNAETQVNTTEELERLVVATRDGKVIRLADIAKVSLEKSHDTYRATANGREAVV
FT                   LAINAAPTANPINIAHDVLEMLPSLKSNMPSTMEANVLYDSTVAINESISEVIKTIAEA
FT                   AAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMVMQMFGFSINLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHVKEGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIALMGGITGSL
FT                   FKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEEPGKFESKVHHLLDRMTVRYDAML
FT                   HAVMQKRIVVVLFAVIVFASLPMLFKFIPSELAPNEDKGVMAVLGTAPSNVNLDYIQGT
FT                   MEQVNKVLDEQPEVAFSQVFSGVFNANQAFGIASMVPWSQREASQKEVLERVGKLVENV
FT                   PGMSITTFQFPELPGASSGLPIQFVITTPNNFESLYQVASEILTAAQGSGRFVYSELDL
FT                   QYDSATMKIKIDKDKAGAYGITMQDIGITLGTMMSDGYVNRIDLDGRSYEVIPQVERKY
FT                   RLNPESIKGYYVRAADGQSIPLGSLISIEVVGEPRALPHFNQLNSATIGAVLMPGTTMG
FT                   NAIAWLDATASEKLPQGYRYDYMGEARQFVTEGSALYATFALALAIIFLVLAIQFESAR
FT                   DPLVIMVSVPLAISGALIALAWGAATMNIYSQVGLITLVGLITKHGILICEVAKEEQLL
FT                   HGRNRMEAVMAAAKVRLRPILMTTAAMIAGLIPLLYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
     atgcgcttta ccgatatatt catcaagcgg cccatcctgg ccatctcgat cagctttctg        60
     atcgcgttgc tgggtgtcca ggccgtgttc aagatgcagg tgcgggaata ccccgagatg       120
     accaacacgg tcgtcacggt cagcaccagc tactatggcg cgagtgccga cctgatccag       180
     ggcttcatca cccagccact ggaacaggcc atcgcccagg cggacaacat cgacttcatg       240
     acgtcgtcca cccagctcgg cagctcgacc atcactgcct acatgaagct caacaccaac       300
     ccgaatgcgg ccctgtccga cattctggcc aaggtcaact cggtacgttc ccagttgccg       360
     aaggagtcgg aagatccctc ggtaaccatg tcgaccggct cgaccacggc ggtgctctac       420
     atcggcttca ccagccccga gctcaacgcc agccagatca ccgactacct ggagcgggtc       480
     atcaagcccc agctctttac cgtcggcggc gtctccaagg tcgacatgta cggtggtacc       540
     aagtacgccc tgcgggtgtg gctggatccg gccaagatgg cggcgttcaa cctgaccgcc       600
     gcggacgtga tgagcgtgct caacagcaac aactatcagt ccgccaccgg ccaggccacc       660
     ggctacttca ccctctacaa cggcaatgcc gagacccagg tcaacaccac cgaggagctc       720
     gagcgcctgg tggtggccac ccgtgacggc aaggtgatcc gtctggcaga catcgccaag       780
     gtcagcctgg agaagagcca cgatacctat cgcgccaccg ccaacggccg cgaggccgtg       840
     gtactggcca tcaacgcggc gccgaccgcc aacccgatca acatcgccca cgacgtgctg       900
     gagatgctgc cgagtctgaa gagcaacatg ccgagcacca tggaggccaa cgtcctctat       960
     gactcgaccg ttgccatcaa cgaatcgatc agcgaggtga tcaagaccat cgccgaggca      1020
     gccgccatcg tgctggtggt gatcaccctg ttccttggtt cgttccgggc ggtcatcatc      1080
     ccgattatca ccattcctct cagcctgatc ggggtggtga tggtgatgca gatgttcggc      1140
     ttctccatca acctgatgac cctgctggcc atggtgctgg ccatcggtct ggtggtggat      1200
     gacgccatcg tggtgctgga gaacgtggat cgccacgtca aggaggggga agaaccgttc      1260
     cgggccgcca tcataggtac ccgtgaaatc gccgtgccgg tcatcgccat gacggtcacc      1320
     ctggccgccg tgtatgcgcc gatcgccctg atggggggca tcaccggctc cctgttcaag      1380
     gagtttgccc tcaccctggc cggcgccgtg ttcgtgtcgg gcatcatagc gctgacactg      1440
     tcgcccatga tgtgcgccaa gatgctcaag gccaacgaag agccgggcaa gttcgagagc      1500
     aaggtgcatc atctgctcga ccgcatgacg gtccgctacg atgccatgct gcacgccgtg      1560
     atgcagaagc gcatcgtggt ggtgctgttc gccgtcatcg tcttcgccag cctgccgatg      1620
     ctgttcaagt tcattccgag cgaactggca ccgaacgaag acaagggcgt catggccgtg      1680
     ctgggtaccg ccccctccaa cgtcaacctg gactacatcc agggcaccat ggagcaggtg      1740
     aacaaggtgc tggacgaaca gccggaagtg gccttctccc aggtcttctc cggggtgttc      1800
     aacgccaacc aggcgttcgg tatcgcctcc atggtgccgt ggagccagcg tgaagcgagc      1860
     cagaaagagg tgctggaacg ggttggcaag ctggtcgaga acgtgcccgg catgtccatc      1920
     accaccttcc agttcccgga attgccgggt gcctcgagcg gcctgccgat ccagttcgtc      1980
     atcaccacgc ccaacaactt cgagagcctc tatcaggtgg cgagcgagat cctgaccgca      2040
     gcccagggga gcggacgctt cgtctactcc gaactggacc tgcagtacga ctccgccacc      2100
     atgaagatca agatcgacaa ggacaaggcg ggtgcctacg gcatcaccat gcaggacatc      2160
     ggcatcaccc tgggcaccat gatgtcggat ggttacgtca accggatcga cctggatggc      2220
     cgctcctacg aggtgatccc gcaggtcgag cgcaaatacc gcctcaaccc cgagtcgatc      2280
     aagggctact acgtgcgggc ggccgacggc cagtctatcc cgctcggcag cctgatcagc      2340
     atcgaggtgg tcggcgagcc gcgcgccctg ccccacttca accagctcaa ctcggccacc      2400
     ataggtgccg tgctgatgcc gggcaccacc atgggcaacg ccatcgcctg gctggatgcc      2460
     accgccagcg agaagctacc gcagggttac cgttacgact acatgggtga agcccgccag      2520
     ttcgtgaccg aaggcagcgc cctgtacgcc accttcgccc tggcgctggc catcatcttc      2580
     ctggtgctgg cgatccagtt cgagtcggcc cgcgacccgc tggtgatcat ggtctccgta      2640
     ccgctggcca tcagtggcgc actgatcgcg ctggcctggg gtgccgccac catgaacatc      2700
     tactctcagg tgggtctgat cactctggtc ggcctgatta ccaagcacgg tatcctgatc      2760
     tgcgaggtgg ccaaggagga gcaactgctg cacggtcgca accggatgga agccgtgatg      2820
     gccgccgcca aggtgcgtct gcgccccatc ctgatgacca cggccgccat gatcgccggt      2880
     ctcatcccgc tgctctatgc aacgggggcc ggggcagccc agcgattcag catcggcatc      2940
     gtgatcgtgg ccggtctggc catcggtacc ctgttcaccc tgttcgtgct gccggtgatc      3000
     tacacctacc tggcctccga acacaaaccg ctgccggtgt ttgacgaatc cattccgccc      3060
     aaggcgaaag ggagtcatta a                                                3081
//

If you have problems or comments...

PBIL Back to PBIL home page