(data stored in ACNUC7421 zone)

EMBL: CP000462.PE213

CP000462.PE213       Location/Qualifiers
FT   CDS_pept        complement(253498..254166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0232"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39357"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU4"
FT                   /protein_id="ABK39357.1"
FT                   /translation="MQHYRELEQNTLANTGQAAGRIRINAPVTFGSYRLTPLLCRFMER
FT                   YPQIRIELDLSDRLVDVIGDGFDLIFRVGQPKDAGYIARPLASSDSVICASPHYLQRHG
FT                   TPLTLADLARHHCLGFSPWLGQSNLAEAFPLEQLHLWDSPFISNHGSALKVAALNHAGI
FT                   LLQPRALLREELERGTLQEILADALPAPRPVNLLYPAREPLPLRLRLLIDYLSEQRHQL
FT                   "
     ttgcagcact accgggagct ggagcagaac accctggcca ataccggcca ggcagcgggc        60
     aggatccgca tcaatgcccc cgtcaccttc ggcagctacc ggctgacgcc gctgctgtgc       120
     cgcttcatgg agcgttaccc gcagatccgc atcgagctgg atctgtcgga tcgactggtg       180
     gacgtcatcg gtgatggctt cgatctgatt ttccgggtcg gtcagcccaa ggacgccggc       240
     tacatcgccc ggccactggc cagttccgat tcggtaatct gcgcgtcccc gcactacctg       300
     caacgccacg gtactcccct cacgctggcg gatctggccc gccaccactg cctgggattc       360
     agcccctggc tcggccagtc gaacctggcc gaggcctttc cactcgaaca gctgcacctg       420
     tgggatagcc ccttcatcag caaccacggc agcgccctca aggtggccgc cctcaaccac       480
     gccggcatcc tgctgcagcc gcgcgccctg ctgcgcgagg agctagaacg cggcaccctg       540
     caggagatcc tggcggatgc cctgcccgcc ccgcgcccgg tcaacctgct ctacccggcc       600
     agggaacccc tgccactgcg cctgcggctg ctcatcgact acctgagcga gcagcgccac       660
     cagctgtag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page