(data stored in ACNUC7421 zone)

EMBL: CP000462.PE214

CP000462.PE214       Location/Qualifiers
FT   CDS_pept        complement(254191..254382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0233"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39859"
FT                   /db_xref="GOA:A0KEU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU5"
FT                   /protein_id="ABK39859.1"
FT                   /translation="MDRLTAIEIFVEVARAGSFAAVAERFAMTPAMIGKYIKWLEARVG
FT                   SRLLNRNTRRQSLTEAGQ"
     gtggatcgct tgacggccat cgagatcttc gtcgaggttg cccgcgcggg cagtttcgcc        60
     gccgtggcgg agcgtttcgc gatgacgccg gccatgatcg gcaagtacat caagtggctg       120
     gaggccaggg tcggctcccg cctgctcaat cgcaacaccc gtcgccagag cctgaccgag       180
     gcgggtcagt ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page