(data stored in ACNUC7421 zone)

EMBL: CP000462.PE215

CP000462.PE215       Location/Qualifiers
FT   CDS_pept        254484..255104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0234"
FT                   /product="lysine exporter protein, putative"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38904"
FT                   /db_xref="GOA:A0KEU6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU6"
FT                   /protein_id="ABK38904.1"
FT                   /translation="MTLDYYTLYLLLAIGTVLSPGPAVIYTIGNTLTRGTRHAIAGFCG
FT                   VAVGILLVASLASLAVLWFTRWLAAGQQILTLGGALYLLYLGLNSWRQRAVSPVPGAGP
FT                   DRDCRRSFIKGALISLLNPKAIIFFTSLFPQFIDFRHGALGQCMLLAVTFSAVVLVVHG
FT                   GYCLVFHWVGAQGYGERFARGINRLSAVMFTGFALLLLFKGLR"
     atgacactcg actattacac cctctatctg ctgctcgcca tcggcactgt gctgagcccg        60
     gggcccgccg tgatctacac cataggcaac accctgaccc ggggcacccg ccacgccatc       120
     gccggctttt gcggggtggc ggtgggcatc ctgctggtgg cgagcctggc ctcgctggcg       180
     gtgctctggt tcacccgctg gctggccgcg ggccagcaga tcctcaccct gggcggcgca       240
     ctctatctgc tctatctggg gctcaactcc tggcgccagc gggcggtgag cccggtgccg       300
     ggggccgggc cggatcggga ttgccgccgc agcttcatca agggggcgct catcagcctg       360
     ctcaacccca aggcgatcat cttctttacc agcctgtttc cccagttcat cgactttcgt       420
     cacggggccc tgggccagtg catgctgctg gcggtcacct tcagcgccgt ggtgctggtg       480
     gtgcatggcg gctactgcct ggtgttccac tgggtggggg cgcaaggcta tggcgaacgc       540
     ttcgccaggg gaatcaaccg gctgtcggcg gtgatgttca ccggcttcgc cctgttgctg       600
     ctgttcaagg ggttgaggta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page