(data stored in ACNUC7421 zone)

EMBL: CP000462.PE217

CP000462.PE217       Location/Qualifiers
FT   CDS_pept        complement(256511..257545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0236"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37575"
FT                   /db_xref="GOA:A0KEU8"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU8"
FT                   /protein_id="ABK37575.1"
FT                   /translation="MKWALMALIGFGFGFTLSFSRFGIVFGWREMLTKRNSYYVRVHLL
FT                   TIAIEILLFTCFLSFSHALFGDAMVGNVMAIGIPFIVGAFLFGIGMQLAGVCATGTLYC
FT                   CGEGQPRFWLVLLCYGIGTLISNQLRPELEATFSSHVVLAKDLTGNIWSGMLLNLALVA
FT                   ALFLLFRKSELKRTGELKPLFSGGNLFWRDGRFTVLTGGIIIALLNSSVVALHGSAWTI
FT                   TGAVYDMALRGASLFGLFEGNPKLAQPLFINPMVGMFWLGILGAMLARCISGGGTFAPM
FT                   RLGNSLASILGGLLMGMGAMYSACNLGGFFDGTASGSLHGWVWMLMALAGSLIGIRLRP
FT                   LFKL"
     atgaaatggg ctctgatggc cctgatcgga ttcggcttcg gcttcaccct ctccttcagc        60
     cgcttcggca tcgtgttcgg ttggcgcgag atgctgacca agcgcaacag ctactacgtg       120
     cgggttcacc tgctcaccat cgccatcgaa attctgctgt tcacctgctt cctctccttt       180
     agccacgccc tgtttggcga tgccatggtg ggcaacgtga tggccatcgg cattcccttc       240
     atcgtcggcg ccttcctgtt cggcatcggc atgcagctgg cgggtgtctg cgccaccggc       300
     accctttact gctgcggcga ggggcaaccc cgcttctggc tggtgctgct ctgctacggc       360
     ataggcaccc tgatcagcaa ccagctccgc cccgaactgg aggccacctt ctccagccat       420
     gtggtactgg caaaagacct gaccggcaat atctggagcg gcatgctgct caacctggcg       480
     ctggtcgccg cgctgttcct gctgtttcgc aagagcgagc tcaaacgcac tggcgagctc       540
     aagcccctct tcagcggcgg caacctgttc tggcgcgatg gccgcttcac cgtgctgacc       600
     ggcggcatca tcatagctct gctcaactcc agcgtcgtcg ctctgcacgg ctcggcctgg       660
     accatcaccg gcgccgtcta tgacatggcg ctgcgcggtg cctccctgtt cggcctgttc       720
     gaggggaacc ccaagctggc ccaaccgctg ttcatcaacc ccatggtcgg catgttctgg       780
     ctggggatcc tgggggccat gctggcgcgc tgcattagcg gtggcggcac cttcgccccg       840
     atgcggctcg gcaacagcct ggcctccatc ctcggcggcc tgctgatggg gatgggcgcc       900
     atgtacagcg cctgcaacct cggcggtttc ttcgacggca ccgcctccgg cagcctgcac       960
     ggctgggtct ggatgctgat ggccctcgcc ggcagcctga tcggcatccg cctgcgcccg      1020
     ctgttcaagc tctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page