(data stored in ACNUC7421 zone)

EMBL: CP000462.PE221

CP000462.PE221       Location/Qualifiers
FT   CDS_pept        complement(264194..265012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0240"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38375"
FT                   /db_xref="GOA:A0KEV2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV2"
FT                   /protein_id="ABK38375.1"
FT                   /translation="MSAPQSRIHYWQSRLLPGVELSHSHHREFSYGRHVHLDYHIGLVQ
FT                   QGGQKFIHKGSSHHLVRGELSTVNPDEMHDGLSLLPEGYEVRVFAIAPEQLARWLPDSP
FT                   EPFFDQGLQRRPDLYQGFARLHMYLDNPSPDGLLAESELLALLGELLHLAPERHALADP
FT                   QLRYLRDHLLARLDERHSLEDLAALFGLDRFAFLRQFKKKTGMTPYAWLKRLRLEQSKR
FT                   LLGSGLPVSEVALAVGFFDQSHFHHGFRQAFGLTPADFRQQMLAASGHAD"
     atgagcgcac cccaatcccg catccactac tggcaatccc ggctgctgcc gggggtcgaa        60
     ctctcccact cccaccacag ggaattcagc tatggccgcc atgtgcacct ggactaccac       120
     ataggtctgg tgcagcaggg cggccagaaa ttcatccaca agggcagcag ccaccacctg       180
     gtgcgcggcg agctctccac tgtcaacccg gacgagatgc acgacggcct cagcctgctg       240
     ccggaagggt acgaggtgcg ggtgttcgcc atcgcccccg agcagctggc tcgctggctg       300
     ccggacagcc cggaaccctt cttcgaccag gggctgcagc gccgccccga cctctatcag       360
     ggatttgccc ggctgcacat gtacctggac aaccccagcc ccgacggcct gctggcggag       420
     agcgagctgc tggccctgct cggcgagctg ctgcacctgg caccggagcg ccacgccctg       480
     gccgaccccc agctcaggta tctgcgcgac catctgctgg cccggctgga tgaacgccac       540
     agtctggagg atctggccgc cctgttcgga ctggatcgct tcgccttcct gcgccagttc       600
     aagaagaaga ccggcatgac cccctacgcc tggctcaagc gactacggct cgaacagagc       660
     aagcgcctgc tcggcagcgg cctgccggtg agcgaggtgg cgctggcggt cggcttcttc       720
     gatcagagcc acttccacca cggctttcgc caggcgttcg gcctcacccc cgccgatttt       780
     cgccagcaga tgctggccgc cagtgggcac gccgactaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page