(data stored in ACNUC7421 zone)

EMBL: CP000462.PE225

CP000462.PE225       Location/Qualifiers
FT   CDS_pept        complement(268165..268707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0244"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35838"
FT                   /db_xref="GOA:A0KEV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV6"
FT                   /protein_id="ABK35838.1"
FT                   /translation="MDIGHRLKAVRTKAALSQRELAKRSGVTNGFISQIEKNQVSPSVA
FT                   SLRKVLEGIPMSLATFFTDETEMDSEVIFRAADMPDLGTHPISYRLVGHSRANRAIGMM
FT                   QEILPPGADTGDDMLSHEGEECGIVIQGQVEVTVGEQVYLLTPGDGYYFDSRTPHRFRN
FT                   VDEHECVLISANTPASF"
     atggatatcg gtcaccgcct caaggcggtt cgcaccaagg cggccctctc ccagcgcgag        60
     ctggcgaaac gctccggtgt gaccaacggc tttatctccc agatcgagaa aaatcaggtg       120
     agcccctcgg tcgcttcttt gcgcaaggtg ctggaaggca ttcccatgtc gctggccacc       180
     ttcttcaccg atgagacgga gatggactcc gaggtgatct tccgcgctgc cgacatgccg       240
     gatctcggca cccaccccat cagctaccgc ctggtgggcc acagccgcgc caaccgtgcc       300
     atcggcatga tgcaggagat actgccaccg ggcgccgaca cgggtgacga catgctgagc       360
     cacgaaggcg aagagtgcgg catcgtcatc cagggtcagg tggaggtcac cgtcggcgag       420
     caggtctacc tgctgacgcc aggggacggc tactacttcg acagccgcac cccgcaccgt       480
     ttccgcaatg tggatgagca cgaatgcgtg ctgatctcgg ccaacacccc cgccagcttc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page