(data stored in ACNUC7421 zone)

EMBL: CP000462.PE226

CP000462.PE226       Location/Qualifiers
FT   CDS_pept        268893..270224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0245"
FT                   /product="omega-amino acid--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36563"
FT                   /db_xref="GOA:A0KEV7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV7"
FT                   /protein_id="ABK36563.1"
FT                   /translation="MKPISDINTPSDMSAFWMPFTANQQFKAAPRILKSAEGMYYHSED
FT                   GRKILDGTAGLWCCNAGHGRREIAEAVSQQISHLDFAPTFQMGHPLPFELANRLVEIAP
FT                   KGLGHVFYTNSGSESVDTALKIALAWQRARGQGTRTRLIGRERGYHGVGFGGISVGGIP
FT                   GNRKWFGSLLGGVDHLPHTLNIAKNAFTKGLPEEDVALADELEKIVFLHDASNIAAVIV
FT                   EPIAGSTGVLMPPKGYLKRLREICTKHGILLIFDEVITGFGRLGAPFAAQEFDVIPDMI
FT                   TCAKGLTNGAIPMGAVLVSNAIYDDMMAAGKGAIELFHGYTYSGHPVAAAAGLATLEIY
FT                   RNENLLSRAADLAGYWEEAAHSLKGCKHVKDVRNYGLVAGIELESMPDAPGKRAYEVFV
FT                   RCFEKGALIRVTGDIIALSPPLIIERSQIDDLFTLLQDALQAQD"
     atgaaaccga tcagcgacat caataccccc tccgacatgt ccgctttctg gatgccgttc        60
     accgccaacc agcagttcaa ggcggcgccg cgcatcctga agtcggcaga ggggatgtat       120
     tatcactcag aggatggccg caagatactg gatggcactg ccgggctctg gtgttgcaac       180
     gcgggtcatg gtcggcgcga gattgccgag gcagtttccc agcagatttc tcacctcgat       240
     tttgccccca cattccagat ggggcacccc ctgccgttcg agctggccaa ccggctggtg       300
     gagatcgccc ccaaggggct tggccacgtc ttctatacca actccggttc ggagtcggtg       360
     gataccgcgc tcaagatcgc gctggcctgg cagcgggcgc gcggccaggg cacccgtacc       420
     cggctgatcg gccgtgagcg cggttaccac ggggtcggct tcggcggtat ctcggtgggt       480
     gggattcccg gcaaccgcaa gtggtttggc tccctgctgg gcggggtgga tcacctgccc       540
     cacaccctca acatcgccaa gaatgccttc accaaggggc tgcccgagga ggatgtggca       600
     ctggccgacg agctggagaa gatcgtcttc ctgcacgatg ccagcaacat agcggcagtg       660
     attgtcgagc ccatcgccgg cagtaccggc gtgctgatgc cccccaaagg ctacctcaag       720
     cggctgcggg agatctgtac caaacatggc atcctgctga tcttcgacga ggtgatcacc       780
     ggtttcggtc gcctcggtgc tcccttcgcc gcccaggagt tcgacgtcat tcccgacatg       840
     atcacctgtg ccaaggggct gaccaacggc gccatcccca tgggggccgt gctggtgagc       900
     aacgccatct atgacgacat gatggcggcc ggcaagggag ccatcgagct gttccacggc       960
     tacacctact ccggccatcc ggtggccgcc gctgcgggcc tggcgaccct cgaaatctat      1020
     cgcaacgaga acctgctgag ccgcgccgcc gatctggcgg gctactggga ggaggcggcc      1080
     cattcgctca agggctgcaa gcacgtgaag gatgtgcgca actacgggct ggtggcgggc      1140
     atcgagctcg aatccatgcc ggatgcgccg ggcaagcgcg cctatgaggt gttcgtgcgc      1200
     tgcttcgaga agggggcgct tatccgggtc accggcgaca tcatcgccct gtcgccgccc      1260
     ctcatcatcg agcgcagcca gatcgacgat ctcttcaccc tgctgcagga cgccctgcag      1320
     gcccaggact ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page