(data stored in ACNUC7421 zone)

EMBL: CP000462.PE230

CP000462.PE230       Location/Qualifiers
FT   CDS_pept        273891..274730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0249"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39068"
FT                   /db_xref="GOA:A0KEW1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW1"
FT                   /protein_id="ABK39068.1"
FT                   /translation="MSRILLLANLNCDHVLSLSEPLVAGARLQYLDQGRRLGGGAANTG
FT                   IGLVWAGHEVTIASRIGLDETGDWLLEQAAGYGLDCSHVERFGGETGELLILVDSTGER
FT                   TILRRPRRPDLPGDLPSEGVDCLYVNYPGTAIIGYMRQMLGKSFVVAQYPKGGQARRPC
FT                   HVLVASRSDLGEVDDPWQHARQIAGEQLAWLVLTEGKAGAVAIHGEEQIRVAARPVSVV
FT                   DTTGAGDAFAGGLIHGLARGMAIRDALQCAVDWGAFAVASESSIPSSALKNWLRQPH"
     atgtcccgca ttctgctgct cgccaatctc aactgtgatc acgtgctctc cctctccgaa        60
     cccctggtgg ccggtgcccg cctgcaatac ctggatcagg gtcgccggct cggcggtggc       120
     gccgccaaca ccggcatcgg gctggtgtgg gccggccacg aggtgaccat cgcctcgcgc       180
     atcgggctgg acgaaactgg cgactggctg ctggagcagg cggcgggcta cggcctggat       240
     tgcagccatg tggagcgctt tggcggcgag accggcgagc tgctgatcct ggtggactcc       300
     accggcgagc gcaccatcct caggcggcca cggcgcccgg acctgccggg tgatctgccg       360
     agcgaggggg tggactgcct ctacgtgaac tacccgggca ccgccatcat cggctacatg       420
     cgccagatgc tcggcaagag cttcgtggtg gctcagtatc ccaagggcgg ccaggcgcgt       480
     cgcccctgcc acgtgctggt ggcttcccgc tccgacctcg gcgaagtgga cgatccctgg       540
     cagcacgccc gccagatcgc cggcgagcag ctggcctggc tggtgctgac cgaaggcaag       600
     gcgggggcgg tggccattca cggcgaggag cagatccggg tggcggcacg gccggtgtcg       660
     gtggtggaca ccacgggggc gggagatgcc ttcgccggcg gcctgatcca cgggctggcg       720
     cgaggcatgg cgatccggga tgcgctgcag tgcgcggtgg actggggtgc cttcgcggtc       780
     gcctccgaga gttccatccc ctccagcgcc ctgaaaaact ggctcaggca gccgcactga       840
//

If you have problems or comments...

PBIL Back to PBIL home page