(data stored in ACNUC7421 zone)

EMBL: CP000462.PE234

CP000462.PE234       Location/Qualifiers
FT   CDS_pept        276404..277744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0253"
FT                   /product="DNA recombination protein RmuC"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37955"
FT                   /db_xref="GOA:A0KEW5"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW5"
FT                   /protein_id="ABK37955.1"
FT                   /translation="MIEPGLWSLLLAGAVLAVGLGWLVGRRGAAQLAQQVLLSEERQQA
FT                   LQDRCDELQDEKLQSQQKLEQQQTLLIKLTARLKDAEATLRSERLAAAEKLQLQQEAEQ
FT                   RLSQQFENLANRIFEQNSGNFRELNQNSLDLLLTPLKEQLEGFRRQVGETHAQETAQRH
FT                   SLKFELERLAELNARMTEEAAALTRALKGDSKQQGNWGEVVLARILSECGLREGHEYHT
FT                   QVNIEVDRGKRYQPDVIVHLPQDKDIIIDAKVSLTAYERWYNSDDELEKAVALKEHVAS
FT                   VRNHIRELGRKDYQQLPGVRTLDYVLMFVAVEPAFLTAVEADPSLVRFGLDNNILLVSP
FT                   TNLMVALRTIENLWRYERQNQNARQIAERAGRLYEKLRLFVEEMQQLGGSLHRAQESYD
FT                   KAMGRLVNGRGNLIAQVERFRELGVEVTKTLPEPLVNRALEREDPAE"
     atgatcgagc ccgggctctg gagcctgctg ctggctggcg ccgtgctggc ggtcggcctc        60
     ggctggctgg tgggccggcg tggtgcggcc cagctggccc agcaggtgct gctgagcgag       120
     gagcgccagc aggcgctgca ggatcgctgt gacgagctgc aggatgaaaa gttgcagagc       180
     cagcaaaagc tggagcagca gcagaccctg ctcatcaagc tcaccgcccg cctcaaggat       240
     gccgaagcca ccctgcgtag cgagcgactg gccgccgccg agaagctgca actgcaacag       300
     gaggcggagc agcgcctcag ccagcagttc gagaacctcg ccaaccggat cttcgagcaa       360
     aactcgggca acttccgtga actgaaccag aacagcctgg atctgctgct gacgccgctc       420
     aaagagcagc tcgagggctt tcgccgccag gtgggggaga cccacgccca ggagacggcc       480
     cagcgccaca gcctcaagtt cgagctggag cgcctggccg agctcaacgc ccgcatgacc       540
     gaggaggcgg cggcgctgac ccgcgccctc aagggcgaca gcaagcagca gggcaactgg       600
     ggcgaggtgg tgctggcgcg gatcctcagc gaatgcggcc tgcgcgaggg ccacgagtac       660
     cacacccagg tcaacatcga ggtggacagg ggcaagcgct accagcccga cgtcatcgtc       720
     cacctgccgc aggacaagga catcatcatc gacgccaagg tgtcgctgac cgcctacgag       780
     cgctggtaca acagcgatga cgagctggag aaggcggtgg cgctgaaaga gcacgtcgcc       840
     tcggtgcgca accatatccg cgagctgggc cgcaaggatt accagcagct gcccggggtg       900
     cgcaccctcg attacgtgct gatgttcgtg gcggtggagc ccgccttcct taccgcggtg       960
     gaggctgacc cctcgctggt gcgattcggt ctcgacaaca acattctgct ggtgagcccc      1020
     accaacctga tggtggcgct gcgcaccata gagaacctgt ggcgttacga gcggcagaac      1080
     cagaatgccc gccagatcgc cgagcgggcc ggccgcctct acgagaagct gcggctgttc      1140
     gtggaggaga tgcagcagtt gggtggcagc ctgcaccggg cgcaggagag ctacgacaag      1200
     gcgatggggc ggctggtcaa cgggcgcggc aacctgatcg cccaggtgga gcgctttcgc      1260
     gagctggggg tggaggtgac caagaccctg cccgagccgc tggtcaaccg ggcgctggag      1320
     cgggaagacc cggccgagtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page