(data stored in ACNUC7421 zone)

EMBL: CP000462.PE24

CP000462.PE24        Location/Qualifiers
FT   CDS_pept        29998..30399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0028"
FT                   /product="ricin-type beta-trefoil lectin domain, putative"
FT                   /note="identified by match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35934"
FT                   /db_xref="GOA:A0KED0"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED0"
FT                   /protein_id="ABK35934.1"
FT                   /translation="MQSTATSALVTDAGFCVALNDHNQLITQPCDQTVRQQFSWDAGAL
FT                   QLDQRCLVAKGVSELTMAECQDESRQWQWQEDRLFNSKADRCLDVAGRRHKPGTPLRLA
FT                   DCFGGANQSFAWQNKSSMFDKLNLKSLIW"
     atgcagagta ccgccacctc tgcgctggta accgatgccg gattctgcgt ggccctcaat        60
     gaccacaatc agctgatcac ccagccttgt gaccagactg ttcgccagca gttcagctgg       120
     gatgccggtg ccttgcagct tgaccagcgt tgcctggtgg ccaaaggggt gagcgagctg       180
     accatggccg agtgccagga tgagagccgg caatggcagt ggcaggaaga tcggctgttc       240
     aacagcaagg ctgaccgctg tctggatgtg gccggccgtc gtcacaagcc gggcaccccg       300
     ctgcggttgg ccgactgttt cggcggggcc aaccagagct tcgcatggca gaacaagagc       360
     agcatgttcg acaagctgaa cctgaaaagc ctcatctggt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page