(data stored in ACNUC7421 zone)

EMBL: CP000462.PE240

CP000462.PE240       Location/Qualifiers
FT   CDS_pept        283840..284928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0259"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38866"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX1"
FT                   /protein_id="ABK38866.1"
FT                   /translation="MYLKQTILACLLATLSQGVLADQLKLKAGYPETYVVQKGDTLWDI
FT                   SGQYLAEPWLWPRLWNINPQIANPHWIYPGDVLHLSWVNGEPRLGKAMQGGKQVVRLSP
FT                   KSRYENKANPIPTLPLSEIGPFLQTDHILADSQQAKQLPYVLGNDEAHIGMLEGDTLYV
FT                   QGSLIPGQDYGIYHPGTIYKDKKSGEQLGQEAVFVGTARAEALLPDGRTRVTLSHNQRE
FT                   VYQGDKLMPFPPQESLSAVFTPKAAPIISPGYIVDLPSKARGGGKFDVVLINKGIRDQV
FT                   APGDVLEILRPGARLVSKNGKVAYREYSSVYDKAFYSTGKPPLPSEAVARVMLFKVYDK
FT                   LSYGLILQSQDMVSTGYQVSNF"
     atgtatctga agcaaaccat cctcgcctgt ctgttggcca ccctgagcca gggcgtgctg        60
     gccgaccagc tgaaactgaa agcgggttat cccgagacct atgtggtgca aaaaggcgat       120
     accctctggg atatttccgg ccagtatctg gcagaaccct ggctatggcc aaggctctgg       180
     aacatcaacc cgcagatcgc caatccgcac tggatctacc cgggcgatgt gctgcacctg       240
     agctgggtca acggcgaacc gcgccttggc aaggcgatgc agggcggcaa gcaggttgtt       300
     cgtctctctc ccaagagtcg ttacgagaac aaggccaacc ccattccaac cctgccgctc       360
     agcgagatcg gccctttcct gcaaaccgac catattctgg ctgacagcca gcaggcaaag       420
     cagctgcctt atgtgctggg caatgatgag gcgcacatcg gcatgctgga gggagatacc       480
     ctctacgtac agggctcgct gatcccgggt caggactatg gcatctatca tccggggacc       540
     atctacaaag acaagaagag tggcgaacag ctggggcaag aggcggtctt cgtcggcacg       600
     gccagggcgg aagccctgct gccggacggc cgcacccggg ttaccctcag ccacaaccag       660
     cgcgaggtgt atcaggggga caagctgatg ccgttcccgc cgcaggagag cctctccgcc       720
     gtgttcacgc ccaaggctgc ccccatcatc tcgcccggct atatcgtcga cttgccgagc       780
     aaggctcgcg gcggtggcaa gttcgacgtc gtgctcatca acaagggcat acgtgatcag       840
     gttgcccccg gcgatgtgct ggagatactg cggcccggcg cccggctggt gagcaagaat       900
     ggcaaggtcg cctatcggga gtactcctcc gtctatgaca aggccttcta ttcgaccggc       960
     aagccacccc tgccgtcaga ggccgtggcc cgagtcatgt tgttcaaggt gtacgacaag      1020
     ctgagttatg gcctgatcct gcagagtcag gacatggtca gcaccggtta tcaggtcagc      1080
     aacttctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page