(data stored in ACNUC7421 zone)

EMBL: CP000462.PE242

CP000462.PE242       Location/Qualifiers
FT   CDS_pept        286038..286511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04361"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39398"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX3"
FT                   /protein_id="ABK39398.1"
FT                   /translation="MFDVLMYLFETYIHSDADVMVEQNELTDELSRAGFDKDEIEKALN
FT                   WLERLANLHDSEREVYVAASAQGSMRIYAPQELARLSTECRGFLLFLEQAQVLNAETRE
FT                   ICIERLLELDKPDIELDDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVIH"
     atgtttgatg tattgatgta ccttttcgag acctacatcc acagcgatgc agatgtgatg        60
     gtcgagcaga atgaactcac cgacgaactg agccgggcag gtttcgacaa agacgagatc       120
     gagaaggcgc tcaactggct ggagcgactg gccaacctgc atgacagcga gcgggaggtc       180
     tacgtcgccg ccagcgcgca aggctccatg cgtatctatg ctccacaaga actggcacgc       240
     ctcagtaccg aatgccgcgg tttcctgctg tttctggaac aagcccaggt actcaatgcc       300
     gaaacccgcg aaatctgcat cgagcgcctg ctcgagcttg ataaaccgga tatcgagctg       360
     gacgatctga agtgggtcgt catgatggtg ctgttcaacg taccgggcag cgaaaatgcc       420
     taccagcaga tggaagagct ggtgtttgat gagtcggacg gcgtcatcca ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page