(data stored in ACNUC7421 zone)

EMBL: CP000462.PE243

CP000462.PE243       Location/Qualifiers
FT   CDS_pept        286567..287124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0262"
FT                   /product="topoisomerase DNA-binding C4 zinc finger domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38729"
FT                   /db_xref="GOA:A0KEX4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX4"
FT                   /protein_id="ABK38729.1"
FT                   /translation="MSKIDHHLFSAHEHAFEREPCPQCGAELVIRQGKHGPFLGCSAYP
FT                   VCDYIRSLTPSGRDIEKVLEGSACPDCGQPLAIKKGRYGLFVGCTQYPACQHIESLQES
FT                   DDTQILCPECGKGHLISRTSRYGKQFYSCDGYPHCKYVVNDKPVPMPCPQCGWGIMVEK
FT                   KVRGALRWICPQKKCGHQSEQV"
     atgtcaaaaa tcgatcatca cctcttttca gcccacgaac atgccttcga gcgcgaaccg        60
     tgcccgcagt gtggtgccga gctggtgatc cgccagggca agcatggtcc cttcctcggt       120
     tgctccgcct atcctgtctg tgattacatc cgctctctga ctccgtccgg ccgtgacatc       180
     gagaaggtgc ttgagggctc ggcctgcccg gattgcggcc aaccgctggc gatcaagaag       240
     gggcgttatg gcctgtttgt cggctgcacc cagtacccgg cctgccagca catcgaatcc       300
     ctgcaggaga gcgacgatac ccaaatcctc tgcccggagt gtggcaaggg acacctcatc       360
     agccgaacct cccgctatgg caagcagttc tactcttgcg acggctaccc ccattgcaaa       420
     tatgtggtga atgacaagcc ggtccccatg ccttgcccgc aatgtggctg gggtatcatg       480
     gtcgagaaaa aggtgagggg agcactgcgc tggatctgcc cgcaaaagaa atgcggccac       540
     cagagcgagc aggtataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page