(data stored in ACNUC7421 zone)

EMBL: CP000462.PE250

CP000462.PE250       Location/Qualifiers
FT   CDS_pept        292127..292783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0269"
FT                   /product="cytochrome c4"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37649"
FT                   /db_xref="GOA:A0KEY1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY1"
FT                   /protein_id="ABK37649.1"
FT                   /translation="MGSGSLITRSWNAMKNLVITLALMVGVTGMAQAKGDAAAGQTKAA
FT                   VCAACHGPDGNSLVDMYPKIAGQHASYIKKQLVELKAAASGQTGRVAPIMGPMALPLSE
FT                   QDMEDLAAYFSSQKVTPLAVPDDAVAAGKALYMGGDMSRGLAACTACHGPRGSGVEQAK
FT                   YPSLSGQHPAYIKAQLTAFRAAARDNDPNSMMRDVAKKLTDQDIEVLSKYVAGLH"
     atgggatctg gaagcctaat aacgagaagt tggaacgcca tgaagaacct agtcattact        60
     cttgctctga tggttggcgt aacggggatg gcacaagcca agggcgatgc cgctgcggga       120
     caaaccaagg ctgccgtttg cgcggcttgt catggaccgg acggcaacag cctagtcgat       180
     atgtacccca agattgctgg tcagcacgca tcatatatca aaaagcagtt agttgaactg       240
     aaggctgcag cttctggtca aactggccgg gttgcaccta tcatggggcc gatggcgctt       300
     cctctgtctg aacaggacat ggaagacctg gcagcctact tctccagtca gaaggtgacg       360
     ccgctcgcgg tacccgatga cgccgtcgct gcaggcaagg cgctgtacat gggaggggac       420
     atgagccgtg gtctggctgc ctgtactgcc tgccatggtc cgcgtggttc gggcgtcgag       480
     caggccaagt atccgagcct gtccggccag catcctgcct acatcaaggc ccagctcacg       540
     gcctttaggg ccgctgcccg tgacaacgac ccgaacagca tgatgcggga cgttgccaag       600
     aagctgaccg atcaggatat cgaagtactg tccaaatatg tggcaggtct gcactga          657
//

If you have problems or comments...

PBIL Back to PBIL home page