(data stored in ACNUC7421 zone)

EMBL: CP000462.PE252

CP000462.PE252       Location/Qualifiers
FT   CDS_pept        294201..294641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38990"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY3"
FT                   /protein_id="ABK38990.1"
FT                   /translation="MLAALLGGLILLGLAWYAGTLLARLKRQHDSQQQAVAARNERILE
FT                   SVRVIAHAVRDGQCDYSEGAIRLTNLLDALQIKGGRAFAGEFPGLYGLYEKVKDMPTHE
FT                   VRRALKRNEVMKMDLERSGYEAELEAQILEDVARLKDFQLSR"
     atgctggccg ccttgttggg cggcctgatt ttgttgggac tggcctggta tgctggtacc        60
     ttgctggcgc gtctcaagcg ccagcacgac agtcagcagc aggctgtcgc ggcccgcaat       120
     gaacggatcc tcgagagtgt cagggtgatt gcccatgcgg tacgggatgg tcagtgcgac       180
     tactccgagg gcgccatccg gttgaccaat ctgctggatg cgttgcagat caagggcggt       240
     cgcgcctttg ccggtgaatt tccgggtttg tacggtctct acgagaaggt gaaggatatg       300
     ccgactcatg aggtgagacg ggccctcaaa cgcaatgaag tcatgaagat ggatctcgaa       360
     cgcagtggct atgaggccga gctggaggcg cagatcctcg aggatgtggc cagactgaag       420
     gattttcagt taagccggtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page