(data stored in ACNUC7421 zone)

EMBL: CP000462.PE26

CP000462.PE26        Location/Qualifiers
FT   CDS_pept        complement(31551..32888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0030"
FT                   /product="sugar phosphate permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36462"
FT                   /db_xref="GOA:A0KR11"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR11"
FT                   /protein_id="ABK36462.1"
FT                   /translation="MFNFFKTRADLPVMEASPDKIRSIYRKYQWQVFLGLVLGYAMFYV
FT                   VRMSLNVVKKPMLDSGVVTLEELGVIGSAFLFTYAVGKFSNGFLSDYANIGRFMSVSLG
FT                   LSSICTILMGMNTATFFLVLMWGLNGWFQSVGSAPSCVSIFQWFSPKQRGSVYSIWGGS
FT                   RNIGEGISWILTATIVSYFGWKAGFIGAGIASLIAALCMYLVLKDRPQTYALPEPAVAF
FT                   GETPEIAKKVDPAEIRRAQLFVLKQPAVWLIAAACACMYMSRYAMSSWAVLYLQEQKGY
FT                   SLIDAGFAMSAYPIAGFLGAILAGIISDKLFNANRHIPTLLYGLANVAGMCLMFWGPQS
FT                   RMMDAVALALIGYAIGGLVVFLAGLTACDLMPKTAVGAVKGFIGLCSYIAASIQELVSA
FT                   ALIKTSEIDGVTHYDFSSAQYFWLGASVVSMLLAMTVWNAKKVVNH"
     atgttcaact ttttcaagac gcgagccgac ctgccggtca tggaagcctc gcccgataaa        60
     atccgctcca tttaccgcaa gtaccagtgg caggtcttcc tgggtctggt actcggttac       120
     gccatgttct atgtcgtgcg catgagcctc aacgtggtca agaagcccat gctggactcc       180
     ggcgtggtga ccctggaaga gctgggggtc atcggctccg ccttcctgtt cacctacgcc       240
     gtcggcaagt tctccaacgg tttcctctcc gactacgcca acataggccg cttcatgtcg       300
     gtctcgctgg ggctctcgtc catctgcacc atcctgatgg gcatgaacac cgccaccttc       360
     tttctggtgc tgatgtgggg cctgaacggc tggttccagt ccgtcgggtc cgccccctcc       420
     tgcgtctcca tcttccagtg gttctccccc aagcagcggg gctcggtcta ctccatctgg       480
     ggcggctcgc gcaacatagg ggaaggcatc tcctggatcc tgaccgccac catcgtcagc       540
     tacttcggct ggaaggccgg tttcatcggc gccggcatcg cctccctgat cgccgccctg       600
     tgcatgtatc tggtgctgaa agatcgcccg cagacctacg ccctgccgga gccggccgtc       660
     gcctttggtg aaacacccga gattgccaag aaggtggacc cggccgaaat ccgccgcgcc       720
     cagctgttcg tgctcaagca acccgccgtc tggctcatcg ccgccgcctg cgcctgcatg       780
     tacatgtccc gctacgccat gagctcctgg gctgtgctct acctgcagga gcagaagggc       840
     tacagcctga tcgacgccgg cttcgccatg tcggcctatc ccatcgccgg tttcctcggc       900
     gccattctgg ccgggatcat ctccgacaag ctgttcaacg ccaaccgcca catcccgacc       960
     ctgctctacg gcttggccaa cgtggccggc atgtgcctga tgttctgggg cccgcagagc      1020
     cgcatgatgg atgccgtcgc cctcgccctg atcggttatg ccatcggcgg gctggtggtc      1080
     ttcctggccg ggctgaccgc ctgcgacctg atgcccaaga ccgcagtggg cgccgtgaag      1140
     ggcttcatcg gcctctgctc ctacatcgcc gcctccatcc aggagctggt ctccgccgcc      1200
     ctgatcaaga ccagcgagat cgacggcgtc acccactacg acttcagcag cgcccagtac      1260
     ttctggctcg gagcctccgt ggtctccatg ctgctcgcca tgacggtgtg gaacgccaag      1320
     aaagtcgtca accactga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page