(data stored in ACNUC7421 zone)

EMBL: CP000462.PE260

CP000462.PE260       Location/Qualifiers
FT   CDS_pept        304238..305110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0279"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38475"
FT                   /db_xref="GOA:A0KEZ1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ1"
FT                   /protein_id="ABK38475.1"
FT                   /translation="MQQKFGGRLGHALSFLRHDGGHFAQFVWGRFQQDRLTVTAGYLAY
FT                   VTLLSLVPMIAVVFGMMSAFPVFQSLKQAMEQFVYHNFVPTAGEMLKEYIDGFVANATN
FT                   TTAVGIGALIVVALMLISAIDKNLNYIWRSTQSRPLAQAFAMYWMILTLGPVLIGASIA
FT                   ISSYIFSLRLFGAESLFGIGYLLLRGLPFLFSVLTFLLVYTVVPNCKVRLMHAFIGALV
FT                   AATLFELAKRGFAIYITNFPSYQAIYGALATIPILFVWVYLSWLVVLLGAETTACLGEY
FT                   ERPGADELA"
     atgcagcaga aattcggcgg ccgtctcggc catgccctct cttttttacg ccacgatggc        60
     ggccactttg cccagtttgt ctggggccgt ttccagcagg acaggctgac ggtcactgcc       120
     ggctatctgg cctatgtgac cctgctctcc ctggtgccga tgatcgccgt ggtattcggc       180
     atgatgtcgg cctttccggt gtttcagagc ctgaagcagg cgatggagca gttcgtctat       240
     cacaacttcg tgcctacggc cggcgagatg ctcaaggagt acatcgacgg cttcgtggcc       300
     aacgccacca acaccacggc tgtcggtatc ggcgctctga tcgtggtggc actgatgctg       360
     atctcggcca tcgacaaaaa cctcaactat atctggcgct ccacccagag ccggccgctg       420
     gcgcaggcat tcgccatgta ctggatgatc ctgacactgg ggccggtgct catcggggca       480
     agcatcgcca tctcctccta cattttctcg ctgcggctgt tcggggccga gagcctgttc       540
     ggcatcggct atctgttgct gcgtggcctg ccgttcctgt tctcggtgct cacctttctg       600
     ctggtctata ccgtggtgcc caactgcaag gtgcggctga tgcacgcctt catcggtgcc       660
     ctggtggcgg ccaccctgtt cgagctggcc aagcgcggct ttgccattta catcaccaac       720
     ttcccctcct atcaggccat ctatggcgcg ctggcgacca tccccatcct gtttgtctgg       780
     gtctacctga gctggttggt ggtcttgctt ggtgcggaaa ccaccgcctg cctcggcgaa       840
     tatgagcgac cgggtgccga tgagttggcc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page