(data stored in ACNUC7421 zone)

EMBL: CP000462.PE262

CP000462.PE262       Location/Qualifiers
FT   CDS_pept        complement(305617..306393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39106"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ3"
FT                   /protein_id="ABK39106.1"
FT                   /translation="MGIRFGCRLGGDHPVHSSILELHWSKTILPCKFMDFNLQAYQADH
FT                   LLHLSAKPQRRLTVQENAHHRWLEIDGVVQSAMSLTEPATLCLPHQQVIACLLPEQAGS
FT                   ILELGLGGGDLTRHLHQRWPDARHECVDLDEEVITLYQLFFQPDQHPQRTPTLHQADAL
FT                   AFLEQSEAQYDLILLDLFSQDGNPPLLFQERIYQALAPRLNGELIINLLPRTRLELTRV
FT                   LMLLEQWVGPTTPYPVPGLRNVLLHTAPRYELASDL"
     atgggcatcc ggttcggctg ccgtctgggg ggtgaccacc cggtacatag ttccatcctt        60
     gagttacact ggtcgaaaac catcttgccg tgcaaattca tggacttcaa tctgcaagcg       120
     taccaagccg accacttatt gcacctcagc gccaagcccc agcgccggct caccgtacag       180
     gaaaatgccc atcatcgctg gctggagatc gacggcgtgg tgcagtcggc catgtccctg       240
     accgaacccg ccaccctctg cctgccacat cagcaggtga tcgcctgtct gttgcccgag       300
     caggccggca gcatcctcga gctggggctg gggggcggcg atctcacccg ccatctgcac       360
     cagcgctggc ccgatgcccg tcacgagtgc gtcgacctcg atgaagaggt gatcaccctc       420
     tatcagctgt tctttcagcc cgaccaacac ccgcagcgca cgccgaccct gcaccaggcc       480
     gatgccctcg cctttctgga acagagcgag gcgcaatacg acctcattct gctcgacctg       540
     ttcagccagg acggcaatcc gccgctgctg ttccaggagc ggatctatca ggcgctggcc       600
     ccccgcctga acggtgagct catcatcaac ctcctgccgc gcacccgcct cgagctgacc       660
     cgggtgctaa tgctgctgga gcagtgggtc ggccccacca ccccctaccc ggtgccgggg       720
     ctgcgcaacg tcctgctgca cacggccccc cgctacgagc tggcgtcaga cctgtag          777
//

If you have problems or comments...

PBIL Back to PBIL home page