(data stored in ACNUC7421 zone)

EMBL: CP000462.PE264

CP000462.PE264       Location/Qualifiers
FT   CDS_pept        complement(307439..309505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0283"
FT                   /product="AsmA family"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38401"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ5"
FT                   /protein_id="ABK38401.1"
FT                   /translation="MNSWLRGLLYTLAFLLLFVWVGLGLFDAERAKGPIASWLSQQTGV
FT                   PVTIGRLVFNPLHPYTLLAEQVSYGNAVTLDKIYLEIESIDWLSRDVRIAHLDLIRPAI
FT                   KLPLPNQLPSLPVHSLTIADSTIDRLSLESDGLTLRGLNATLSDWQLLNPVRPPQANLT
FT                   LNINELATPAWALSRLNLAGRLEGQVLSTDKLTANLFDGLLETGMVLDWPARSLRLNNL
FT                   KTQGMRIEWGTLAKAESPLRQVSLDLGQIRDLSFNDIERELALNNLNGQLTAFNWQAGS
FT                   TPSGYFSGTLGDLGRGLFQLEAIQGKVAFSTQQLDAELQGKAYEGEFNLELSLDPLQQK
FT                   LTLKDMALSGMDISLPEGWWQDWQRWRPQQIDIRKLAFDKLKVLSFDDTLPLSLTGWQF
FT                   YLTDLSLRGNQPGPLLGRARLESAWFELVWDGLSARNGELDGELTAGSWQLNKLTSSLP
FT                   DEGSLSLSGQWGREPGQSSRLQLKGEKLDLVQWGKILHSPVSFAGKMDLSADLQALHGG
FT                   TPGAWRSSLQGNIALDATEPFWDKVKIDPLLDQWFKQAAAPTLSPAELWQAMQEGDTPF
FT                   YRIKLQGKVAQGQLKIEQAGASTITHLLGVQGSVDLVNEQWQLDLGVLNGQHCTELLGQ
FT                   WRGKLAEPTLSWSFQQKPDGCGWETGVRYPPQGNSSPLWRPAPKAPAAQAVNG"
     atgaattcct ggctgcgcgg cctgctctac acccttgcct tcctgttgct ctttgtctgg        60
     gtcgggctag gcctgttcga cgccgagcgg gccaaagggc ccatcgccag ctggctcagc       120
     cagcagaccg gcgtgcccgt caccataggc cgactggtat tcaacccgct tcacccctac       180
     accctgctgg cagagcaggt gagttacggc aacgccgtga ccctcgacaa gatctatctc       240
     gagatagaga gcatcgactg gctgagccgc gatgtgcgca tcgcccatct cgatctcatc       300
     cgcccggcca tcaagctgcc gctgcccaac cagctgccga gcctgccggt gcactccctc       360
     accatcgccg acagcaccat cgaccggctc agcctggaga gcgacgggct gaccctgcgc       420
     ggcctcaacg ccaccctgag cgactggcag ttgctcaatc cggtgcgccc gccccaggcc       480
     aacctgaccc tcaacatcaa tgagctggcg accccggcct gggccctctc ccgcctcaat       540
     ctggctggcc ggttggaagg gcaggtgctg agtaccgaca agctgaccgc caacctgttc       600
     gacggtctgc tcgaaaccgg catggtgctc gactggcccg cccgcagcct gcggctgaac       660
     aacctcaaga cccagggcat gcgcatcgag tggggcaccc ttgccaaagc cgaatccccc       720
     ctgcgccagg tcagcctgga tctcggccag atccgggatc tcagcttcaa cgacatcgag       780
     cgagagctgg ccctcaacaa cctcaacggc cagctgaccg ccttcaactg gcaggccggc       840
     agcacgccca gcggctactt ctcggggacc ctcggcgatc tcggccgtgg cctgttccag       900
     ctggaggcca tccagggcaa ggtcgccttc tcgacccagc agctggatgc cgagttgcag       960
     ggcaaggcct atgaagggga gttcaacctg gagctatctc tcgatcccct gcagcagaag      1020
     ctgaccctca aggacatggc gctgagcggc atggacatca gcctgccgga agggtggtgg      1080
     caggattggc agcgctggcg cccgcagcag atcgacatcc gcaagctggc cttcgacaag      1140
     ctcaaggtgc tctccttcga cgataccctg cccttgtcgc tgaccggctg gcagttctat      1200
     ctcaccgatc tcagcctgcg cggcaatcag ccggggccgc tgctgggccg ggcccgcctc      1260
     gagagcgcct ggttcgaact ggtgtgggac ggcctcagcg cccgcaacgg cgagctggat      1320
     ggcgagctga cggccggctc ctggcagctc aacaagctca ccagctcgct gccggatgag      1380
     ggcagcctca gcctgagcgg ccagtgggga cgcgagccgg gccagtccag ccggttgcag      1440
     ctcaagggcg agaaactgga tctggtgcag tggggcaaga tcctccactc ccccgtctcc      1500
     ttcgccggca agatggatct gagcgccgat ctgcaggcgc tgcacggcgg caccccgggc      1560
     gcctggcgca gctccctgca ggggaacatt gcgctcgatg ccaccgagcc gttctgggac      1620
     aaggtgaaga tagatccgct gctcgatcag tggttcaagc aggcggcggc accgaccctc      1680
     agcccggccg agctctggca ggcgatgcag gagggtgaca ctcccttcta tcgcatcaag      1740
     ctgcagggca aggtggcgca gggccagctg aagatcgagc aggccggcgc ctccaccatc      1800
     acccacctgc tgggggtgca gggcagcgtc gatctggtca atgagcagtg gcagctggat      1860
     ctgggcgtcc tcaacggcca gcactgcacc gagctgctcg gccagtggcg cgggaagctc      1920
     gccgagccga ccctcagctg gagcttccag caaaaaccgg acggctgtgg ctgggaaacc      1980
     ggtgtacgct acccgcccca gggcaacagc agcccgctct ggcgaccggc gccgaaggcc      2040
     ccggccgcac aggcggtcaa cggctaa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page