(data stored in ACNUC7421 zone)

EMBL: CP000462.PE267

CP000462.PE267       Location/Qualifiers
FT   CDS_pept        complement(313393..314733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0286"
FT                   /product="Low-affinity gluconate transporter"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39685"
FT                   /db_xref="GOA:A0KEZ8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ8"
FT                   /protein_id="ABK39685.1"
FT                   /translation="MSDLSLIMTAAGSIVLLLFLVMKARLHAVVSLILVSMVAGLAAGM
FT                   NPADIAATIQKGMGGTLGFVAVVVALGAMFGKVMEVTGALDRVAHTLLGTFGVKRANWA
FT                   MSLTGFICALPLFFDVAVVLLIGVAFAIVRRGGGSVVKIGIALLAGIATCQAFLIPAPG
FT                   PILVASQLGADFGYMILFGLIAAVPALILAGPLFGELISKVVDVPLPADAQSSAHDDGQ
FT                   NLPSFGLAMGLIGLPLLLIGLKTIVGRFVEAGTPLHGWLEFIGHPFTAIMVACLAAFYL
FT                   LGIRRGMSRDEVMNVCNSAIQPAGVIILVTGAGGVFKQILVDSGVGAALGNMLADSGLP
FT                   IVALAFILAAAVRVIQGSATVAMLTACGLVLPMLEPLGLNGAQLAAVTIAIGGGAIVLS
FT                   HVNDSGFWLANRYLGLTEKQTLQTWTVMETIIGTTGGVMAMIIYSFL"
     atgtctgacc tctccctgat catgacggcc gccggctcca tcgtgctgct gctctttctg        60
     gtgatgaagg cccgcctgca cgcggtcgtc tccctcatcc tggtctccat ggtggcgggg       120
     ctcgccgccg gcatgaaccc ggccgacatc gccgccacca tccagaaagg gatgggcggc       180
     accctcggtt tcgtcgccgt ggtggtggca ctgggcgcca tgttcggcaa ggtgatggaa       240
     gtcaccggcg ccctcgaccg ggtggctcat accctgctcg gtaccttcgg cgtcaagcgc       300
     gccaactggg ccatgtcact gaccggcttc atctgcgctc tgccgctgtt cttcgacgtg       360
     gccgtggtgc tgctgatcgg ggtggccttt gccatcgtcc gtcgcggcgg cggcagcgtg       420
     gtgaagatag gcatcgccct gctggcgggt atcgccacct gccaggcctt cctgatcccg       480
     gcgccgggcc ccattctggt ggcgtcccag ctgggcgccg acttcggcta catgatcctg       540
     ttcggcctga tcgccgccgt tcctgccctg atcctggccg gcccgctgtt tggcgagctg       600
     atcagcaagg tggtggacgt gccgctgccg gccgacgccc agagcagcgc ccacgacgac       660
     ggccagaacc tgccctcctt cgggctggcc atgggcctca tcggtctgcc gctgctgctg       720
     atcggtctca agaccatcgt tgggcgcttc gtcgaggccg gcacacccct gcacggctgg       780
     ctggagttca tcggccaccc cttcaccgcc atcatggtcg cctgcctggc cgccttctac       840
     ctgctgggga tccgtcgcgg catgtcccgt gacgaggtga tgaatgtctg caacagcgcc       900
     atccagccag ccggcgtcat catcctggtg accggtgccg gtggcgtgtt caagcagatc       960
     ctggtggatt ccggcgtggg tgccgccctt ggcaacatgc tggcggactc cggcctgccc      1020
     atcgtcgcgc tggccttcat cctggcagcc gcggtgcggg tcattcaggg ttccgccacc      1080
     gtcgccatgc tgaccgcctg cggtctggtg ctgccgatgc tggagccgct cggcctgaac      1140
     ggcgcccagc tggcggcggt caccatcgcc atcggcggcg gggccatcgt gctctcccac      1200
     gtcaatgact ccggcttctg gctggccaac cgctacctcg gcctcaccga gaagcagacc      1260
     ctgcagacct ggaccgtgat ggagaccatc ataggcacca ccggtggcgt gatggcgatg      1320
     atcatctaca gcttcctctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page