(data stored in ACNUC7421 zone)

EMBL: CP000462.PE272

CP000462.PE272       Location/Qualifiers
FT   CDS_pept        319139..319789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0291"
FT                   /product="Qnr"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38882"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="PDB:3PSS"
FT                   /db_xref="PDB:3PSZ"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF03"
FT                   /protein_id="ABK38882.1"
FT                   /translation="MIKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVDC
FT                   SFYDRESEQSCLLQGCDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRASFA
FT                   NQITVKSYFCEAHLTGNNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSGSEF
FT                   GQIDWASVNLQGCDLRQCDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIVFP"
     atgatcaagg acaagtgctt cgagggcgtg cgcttcgagc agcaagacct ggagggggag        60
     cagttccagg gttgccgttt catcggctgc aacttctcct ggctcgatct ggccgaatgc       120
     cgcttcgtcg actgcagctt ctatgatcgg gagagcgagc agagctgttt gctgcagggt       180
     tgcgacctgc gcgaggcgag cttcctgcgc tgcgatctca ccatggccga ttgcagtcgc       240
     agtcaatgtc tggggctgga gctgcgcgac tgtcaggcgc tggggatcaa cttctcccgg       300
     gccagctttg ccaaccagat caccgtcaag agctacttct gcgaggccca tctgaccggc       360
     aacaacttca gttacgccaa tttcgaaggg tgcctgctgg agcaatgcga attgagcggc       420
     aatcgctggc agggggccaa cctgttcggt gcctcgctgg cgggctccga tctcagcgga       480
     tccgagtttg gccaaataga ctgggccagc gtcaacctgc agggttgtga cctgcgccag       540
     tgcgatctgc cggggctgga tctgcggcgg gtcaatctgg acggggtgca gatcaacgaa       600
     gatcagcagc aggccttgct ggagcagatc gggctgatcg tcttcccctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page