(data stored in ACNUC7421 zone)

EMBL: CP000462.PE275

CP000462.PE275       Location/Qualifiers
FT   CDS_pept        323086..323517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0294"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36766"
FT                   /db_xref="GOA:A0KF06"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF06"
FT                   /protein_id="ABK36766.1"
FT                   /translation="MQEYLDFAARNPLLTAAWFGLAGTLVYTTVRARFSPVKSVNNHTA
FT                   TLLINRENATVVDIRSQEEFAKGHLAGAQHLPLSQIQSNNLGPVEKHKDAPIIVVCESG
FT                   MTAGGAGRQLSKAGFKQVYVLSGGMAQWRAENLPVTKKR"
     atgcaagagt atttggattt tgcggcccgc aacccgctgc tgaccgcagc ctggttcggc        60
     ctggcaggca ccctggttta caccacggtg cgtgctcgtt tttctccggt gaagtcggtg       120
     aacaaccaca ccgcaaccct gctgatcaac cgtgaaaacg ccaccgtagt ggatattcgc       180
     agtcaggaag agtttgccaa gggtcatctg gccggtgccc agcacctgcc gctcagccag       240
     atccagagca ataatctggg cccggttgaa aagcataaag atgcccccat catagtggtg       300
     tgcgagtcgg ggatgaccgc tggtggcgcg ggtcgccaat tgagcaaagc cggcttcaag       360
     caggtgtatg tgctcagcgg tggcatggcc cagtggcgtg cagagaatct gccggtgacc       420
     aaaaaacgct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page