(data stored in ACNUC7421 zone)

EMBL: CP000462.PE282

CP000462.PE282       Location/Qualifiers
FT   CDS_pept        327621..328418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36489"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF13"
FT                   /protein_id="ABK36489.1"
FT                   /translation="MNINVSLPTIIPNQLQPQTESARTDNRRAALIPQSRQSEAFNAES
FT                   EVGSQKEKSRASQANPNQTSQQARDGAQTSNPQAAIDNRFVEAAGEDGQRNKQQDPKQQ
FT                   EQQQKQELQVKELADRDQEVRTHEQAHQSTGGQYAGSPTYEFAMGPDGKRYATGGGVSI
FT                   DIGTIPGDPRATIAKMQQVRAAALAPAEPSSQDLSVARSAAAKEAQARKALLSSDPDTA
FT                   LAADGSAKTGVLNGYMEQRNQVIAQRYQQAVKPAAQQNLNLSV"
     atgaacatca atgtcagtct gccgaccatc attcccaacc agctgcaacc gcagacggaa        60
     tcggcacgca ctgacaatcg tcgcgcggca ctcatccccc agagccgcca gagcgaggct       120
     ttcaacgccg agtccgaagt cggctcccag aaagagaagt ccagagccag ccaggccaat       180
     cccaatcaga cttcccagca ggcacgagac ggtgcccaga ccagcaaccc gcaggcggcg       240
     atcgacaacc gctttgtcga ggccgccggt gaggatggtc agcgcaacaa acagcaggat       300
     cccaagcagc aggagcaaca acagaagcag gagctgcagg tcaaggagct ggccgacagg       360
     gatcaggagg tgcgcactca cgagcaggcg caccagagca ccggtggtca gtatgccggc       420
     agccctacct atgaattcgc catggggccg gatggcaagc gttacgcgac cggcggtggc       480
     gtctccatcg acatcgggac catccccggt gatcccagag ccaccatcgc caagatgcaa       540
     caggtgcggg ccgccgcact ggcgcctgcc gagccctcct ctcaggatct gagcgtggcc       600
     agaagtgctg cggccaagga ggcacaggcc cgcaaggcgc tgctctcatc cgaccctgat       660
     accgccctgg ctgccgatgg cagcgccaag acgggcgtgc tgaacggcta catggagcag       720
     cgcaaccagg tcatcgccca gcgttatcag caggcagtca agccagcggc ccagcagaac       780
     ctgaacctga gtgtctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page