(data stored in ACNUC7421 zone)

EMBL: CP000462.PE283

CP000462.PE283       Location/Qualifiers
FT   CDS_pept        328514..328792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36105"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF14"
FT                   /protein_id="ABK36105.1"
FT                   /translation="MHFDEVKPEDFATFSRVPPPHLQMEQFLMQLGGGGTEGTHFKKKV
FT                   MLAAGWSHTGVVSYGKYPQEACKAFNRLREVLAAHREADAILAALAQ"
     atgcactttg atgaagtcaa accggaagat tttgccacct tctcccgtgt accaccgccg        60
     cacctccaga tggagcagtt cttgatgcag ctcggcgggg gcggcaccga aggcacccat       120
     ttcaagaaga aggtgatgct ggcagcaggt tggagccata ccggcgtggt ttcctatggc       180
     aagtatccgc aagaggcctg caaggcattc aatcggctgc gggaagtgct ggcagcccat       240
     cgggaggctg acgccattct ggctgctctg gcccaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page