(data stored in ACNUC7421 zone)

EMBL: CP000462.PE29

CP000462.PE29        Location/Qualifiers
FT   CDS_pept        36874..38151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0033"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein DctD"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36763"
FT                   /db_xref="GOA:A0KR14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR14"
FT                   /protein_id="ABK36763.1"
FT                   /translation="MLLPANRPANVLLVDDDEDVLESYCHLLRLSGYHPRATTSPHEAL
FT                   ALLADQWPGVLVSDIYMPAMNGMDLLASVQALDAEIPVIMITGHGDIPLAVRAVKQGAF
FT                   DFLEKPLNPQDLLGLLERACRQRSAVLARRSEIQATVDDELIGSSPQIVTLRSQLNQLA
FT                   QTDKDLLLEGPAGSGRHTLARLLHRISARREQAFQLHDCVSAPSLAEVQASLAQAGQGT
FT                   LVLQSPARLSADCQRWLGNHLLDQERKGSKSLRAIGLFDESPEALVERQQLMPELYYFL
FT                   SQVRLKLPRLVERSCDIIPLFRAFLRQGCKRIGRPVPAVDRAYLETLKRHQWPGNLREL
FT                   RNVAELYAVGIVKLAGAEQVIPLASGKEPLDDLVEEFERRVIEDTLFLFSGRVTDAAQY
FT                   LGIPRKKLYLRMKKHQLDKDRFKPAT"
     atgctgttgc ccgctaaccg tcctgccaac gtgctgctgg tggacgatga cgaggacgtg        60
     ctggaatcct attgccacct gctgcggctc tccggctacc accccagggc gacgacttcg       120
     ccccacgagg cgctggcgct gctggcggat cagtggccag gggtgctggt ctctgacatc       180
     tacatgccgg ccatgaacgg catggacctg ctggccagcg tgcaggcgct ggacgctgag       240
     atcccggtca tcatgatcac cggtcacggg gacattccgc tggcggtgcg ggcggtcaag       300
     cagggggcgt tcgactttct ggagaaaccg ctcaatccgc aagatctgtt gggcctgctg       360
     gagcgggcct gccgacagcg cagcgccgtg ctggcgcgcc gcagcgagat ccaggcgacg       420
     gtggatgacg agctgatcgg ctccagtccg cagatagtga cgcttcgcag ccagctcaac       480
     cagctggcac aaaccgacaa ggacctgctg ctggaagggc cggccggctc gggccgtcac       540
     accctggccc ggctgctgca ccggatcagc gcccgccggg agcaagcctt ccagctgcac       600
     gactgtgtct cggcccctag cctggccgag gtgcaagcca gcctggcaca ggcggggcag       660
     ggtaccctgg tgctgcaatc cccggcccgc ctgagtgccg actgccagcg ctggctcggc       720
     aaccacctgc tggatcagga gcgcaagggg agcaagtcgc tgcgtgccat agggttgttt       780
     gacgagtcgc cggaggcgct ggtggaacgc cagcaactga tgccggagct ctactatttc       840
     ctctcccagg tgcggctcaa gctgccccgg ctggtggagc gcagctgtga catcatcccc       900
     ctgttccggg cctttctgcg acagggctgc aagcgcatcg gccggccggt gccggcggtg       960
     gaccgcgcct atctggagac gctcaagcgg catcagtggc ccggcaacct gcgcgagctg      1020
     cgcaacgtgg ccgagctcta tgcggtgggc atcgtcaagc tggccggcgc ggagcaggtt      1080
     atccccctgg ccagcggcaa ggagccgctg gacgacctgg tggaggagtt cgagcggcgg      1140
     gtgatcgagg ataccctgtt cctcttttcc ggccgggtga ccgatgccgc ccagtacctc      1200
     ggcattccgc gcaagaagct ctatctgcgc atgaagaagc accagctcga caaggatcgg      1260
     ttcaagccgg ccacctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page