(data stored in ACNUC7421 zone)

EMBL: CP000462.PE30

CP000462.PE30        Location/Qualifiers
FT   CDS_pept        38203..38517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37253"
FT                   /db_xref="GOA:A0KR10"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR10"
FT                   /protein_id="ABK37253.1"
FT                   /translation="MRCPHCMSEGVARIEDERVKRACALGLGAAGGYACAATLARMGAA
FT                   TGSVLGGVGTVVGALAGALGGAVLGGLMGGGLGWWLGRTLDRRLSRHYRCGVCGHRFSR
FT                   "
     atgagatgcc cgcactgcat gagtgaaggg gtggcacgga tcgaggatga acgggtgaag        60
     cgagcctgcg ccctgggctt gggggccgcg ggcggctatg cctgcgccgc cacgctcgcc       120
     agaatggggg ccgcaacggg ctcggtgctg ggtggtgtcg gtactgtcgt cggtgccctg       180
     gcgggagcgt tgggtggtgc cgtgctggga ggattgatgg ggggagggtt gggctggtgg       240
     ctggggcgta ccctggatcg acgcctgtcc cggcactatc gctgcggggt ctgcggccat       300
     cgcttcagcc gctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page