(data stored in ACNUC7421 zone)

EMBL: CP000462.PE31

CP000462.PE31        Location/Qualifiers
FT   CDS_pept        complement(38565..39377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0035"
FT                   /product="hydrolase, Cof family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37704"
FT                   /db_xref="GOA:A0KR21"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR21"
FT                   /protein_id="ABK37704.1"
FT                   /translation="MYKVVVSDLDGTLLNGQHQISPRTRDTLHRLVDQGIKFVVATGRH
FT                   HVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQALPDGVAAELIALERDPSIHINL
FT                   YYGDEWLVEEEMPWLLQFHHESGFSYRLTDLASHPLDKVNKVFYIGEHEKLLQIEAELN
FT                   QRYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVLEQHGLEMSQAVAFGDGMNDFEMLSM
FT                   VGRGVVMGNAHDRLKLALANHEQTLSSDEDGVAVYLEQLFALQGVNVA"
     atgtataagg tcgttgtatc cgatctcgat ggcaccctgc tcaacgggca gcaccagatc        60
     tccccccgca cccgcgatac cctgcaccgt ctggtggatc aggggatcaa gttcgtggtg       120
     gccaccggcc gtcaccatgt ggatgtgcgc agcatccgcg acacgctcgg gctcgacatc       180
     tatctcatca cctccaatgg cgccgtggtg cacgacaagc aggatcagct gatcttcaac       240
     caggccctgc cggacggcgt ggcggccgag ctgatcgcgc tggagcgcga cccctccatc       300
     cacatcaacc tctactacgg cgacgagtgg ctggtggaag aggagatgcc ttggctgctg       360
     cagttccatc atgaatccgg cttcagctat cgcctgaccg atctcgccag ccacccgctg       420
     gacaaggtca acaaggtgtt ttacatcggc gagcacgaga agctgctgca gatcgaggca       480
     gagctgaacc aacgttatgg tgatcggctc aacgtcacct tctccctgcc ggactgcctc       540
     gaggtgatgc acgccggggt gcacaagggc aatgccgtgc gcgccgtgct ggagcagcac       600
     gggctggaga tgtcccaagc ggtggccttc ggcgacggca tgaacgactt cgagatgctg       660
     agcatggtcg gccgcggcgt ggtgatgggc aatgcccacg accggctcaa gctggcgctg       720
     gccaaccacg aacagaccct gagctccgac gaggatggcg tcgccgtcta tctggagcag       780
     ttgttcgccc tgcagggcgt caacgtcgcc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page