(data stored in ACNUC7421 zone)

EMBL: CP000462.PE317

CP000462.PE317       Location/Qualifiers
FT   CDS_pept        complement(357834..358220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0341"
FT                   /product="SirB family protein"
FT                   /note="identified by match to protein family HMM PF04247"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36429"
FT                   /db_xref="GOA:A0KF48"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF48"
FT                   /protein_id="ABK36429.1"
FT                   /translation="MIAYYPMLKHLHMTLALVSVLLFLYRWLLALGGSPRLQQKWLKIL
FT                   PHVNDTFLLLFGVLLAVTLQMSPGQQPWLMAKLIALVVYIGLGVMALKRPARSQKLVAG
FT                   LAALAVFGYMVGAAITKSALSWLA"
     atgattgcct attaccccat gctcaaacac ctgcacatga cgctggcgct ggtcagcgtg        60
     ctgctgttcc tctatcgctg gctgctggcc ctcggcggca gcccccgcct gcagcagaag       120
     tggctgaaga tcctgcccca tgtcaacgac accttcctgc tgctgttcgg agtgctgctg       180
     gcggtaaccc tgcagatgag cccgggccaa caaccctggc tgatggccaa gctgatcgca       240
     ctggtggttt acatcggcct cggcgtcatg gcgctcaagc gccctgcgcg cagtcagaag       300
     ctggtggccg gcctcgcagc cctggcggta ttcggctata tggtgggcgc ggccatcacc       360
     aaatccgcct tgtcctggct ggcctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page