(data stored in ACNUC7421 zone)

EMBL: CP000462.PE32

CP000462.PE32        Location/Qualifiers
FT   CDS_pept        complement(39471..40511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0036"
FT                   /product="lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38149"
FT                   /db_xref="GOA:A0KR22"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR22"
FT                   /protein_id="ABK38149.1"
FT                   /translation="MNLLSPALLALTLFSAGALAVNNPYQLTPEADVATLHQQTLPDFW
FT                   RQHAVESAFKGKDGITIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLY
FT                   LIDHRGQGLSDRLLADQEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMGGAI
FT                   SARYLERWPDDIEAAVLSSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGPGQGP
FT                   YESHDFADNGLSHSEARYQAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAEAGAIK
FT                   TPLLLLQAGDDGVVDNAAQDAFCALARCEGGKPLRIEGAWHELFMEADPQRQAALNATL
FT                   AFFARY"
     atgaacctgt tatcgcccgc cctgctggcc ctgaccctgt tttctgccgg agccctcgcc        60
     gtgaacaatc cctatcagct gacgccggaa gccgacgtcg ccacccttca tcagcagacc       120
     ctgcccgact tctggcgcca gcacgccgtc gagagcgcct tcaagggcaa ggacggaatc       180
     accatccgct atgccgccct gcgccaggcc aaggtcgatc gcgccatcct catcgtcaac       240
     ggccgggtcg aaagctacct caagtatcag gagctggcct gggatctgtg gcgccaaggc       300
     tacagcctct acctcatcga ccaccgcggc cagggcttgt ccgatcggct tctggccgac       360
     caggagaagg gatatgtcga ccagttcgac gattatgtgc tcgatctcaa gcagtttcat       420
     gacgaggtga tcgcccagga ccagcccgcc aagctgttcc tgctcgccca ctccatgggc       480
     ggcgccatct cggcccgcta tctggagcgc tggcccgatg atatcgaggc ggccgtgctc       540
     tcctccccca tgatgggcat caatctaggc ggcctgccca agtggctggc caaggggctg       600
     gcggccacca tcggcacggt cggcggctgg ctgggcgagc ctccctacgg cccgggccag       660
     ggcccgtacg agagccacga ctttgccgac aacggcctga gccacagcga agcccgctat       720
     caggccttcc gcgagctcta tgagcagcgc ccgcagatca agttgggggg cgccaccgcc       780
     cactggatct atcaggggct gacgggggcg gacgccgccg tggccgaggc cggcgccatc       840
     aagacgccgc tgctgctgct gcaggccggt gatgacggcg tggtggacaa cgccgcgcag       900
     gatgccttct gtgcgctcgc tcgctgcgag ggaggcaagc cgctgcgcat agaaggggcc       960
     tggcacgagc tgttcatgga ggccgatccc cagcgccagg ccgcgctcaa cgcgactctg      1020
     gccttcttcg cacgctacta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page