(data stored in ACNUC7421 zone)

EMBL: CP000462.PE320

CP000462.PE320       Location/Qualifiers
FT   CDS_pept        complement(360821..361717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0344"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37804"
FT                   /db_xref="GOA:A0KF51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF51"
FT                   /protein_id="ABK37804.1"
FT                   /translation="MINIVFRWLSSEKTMVGLMLDLRLLRFFIAIYEEKNITAAAERCH
FT                   VSQPSLSAGLRQLEETLGDSLFIRGKKGVAARDQAHYLYPHAVKLVEEARRLPALFRQK
FT                   ATRARLNMAIMPDLSRRRVAGLLQQVQAVLPELDLTLSDYGTPADCRLTLDALRREDEI
FT                   FLPLWEEDYVLCVRRDHPLASRQQLELAELQHYDFIECPPCEAHQQTIGLLACDRLTLN
FT                   LVAKAESKGLVMALVLAGVGISFLPDGLVEDEAGLCTVPVRGPRMFRRIGLCYPAHQTL
FT                   NPALRELIPELASHGAS"
     gtgataaata ttgttttccg ctggttatca tctgaaaaaa ctatggttgg gcttatgctg        60
     gatctgagac tgctgcgctt cttcatcgcc atctatgaag agaagaacat cacggcggcg       120
     gccgaacgct gccacgtcag ccaaccctcc ctctcggcgg ggctgcgcca gctggaagag       180
     accctgggtg acagcctgtt cattcggggc aagaaggggg tggcggccag ggatcaggcc       240
     cattacctct atccccacgc ggtcaagctg gtggaagagg cacgccggct gccggcgctg       300
     tttcgccaga aggcgacgcg tgcgcggctc aacatggcca tcatgccgga tctgagccgg       360
     cggcgggtgg cgggattgct gcagcaggtg caggctgtgc tgcccgagct ggatctcacc       420
     ctctccgatt acgggacgcc tgccgactgt cggctgaccc tggatgccct gcgcagggag       480
     gacgagatct tcctgccgct gtgggaggag gattatgtct tgtgcgtgcg ccgcgaccat       540
     cccctcgcca gccgccagca actcgagttg gccgagctgc aacattatga ttttattgag       600
     tgccctccct gcgaagccca tcagcagacc ataggtctgc tggcctgtga ccgactgacc       660
     ctcaatctgg tggccaaggc cgaaagcaag gggctggtga tggcgctggt gctggccgga       720
     gtcggcatca gctttctgcc ggacgggttg gtggaggacg aagcgggtct gtgtaccgtg       780
     ccggtgcgcg ggccacggat gttccggcgc atcggcctct gctatcccgc ccaccagacc       840
     ctcaatccgg cgctgcgcga gctgatcccg gaactggcga gccatggcgc ttcttga          897
//

If you have problems or comments...

PBIL Back to PBIL home page