(data stored in ACNUC7421 zone)

EMBL: CP000462.PE323

CP000462.PE323       Location/Qualifiers
FT   CDS_pept        362990..363421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04214"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37618"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF54"
FT                   /protein_id="ABK37618.1"
FT                   /translation="MYKSLLLAVLAGTVSFSALATEQMTVYKSQYCGCCKTWIKHMEEN
FT                   GFEVKVVETEQLEPVKQQYGITPQLASCHTGVVNGYVVEGHVPAADVQKLLKEKPAIRG
FT                   LTIPGMPQSAPGMDIPGQPYQVLSISNEGATKVWSSYPG"
     atgtacaagt ccctgttatt ggccgtgctg gccggtaccg tcagtttttc tgctctggca        60
     accgagcaga tgaccgtcta caagtcccag tattgcggct gctgcaagac ctggatcaag       120
     cacatggaag agaacggctt tgaggtcaag gtcgtcgaaa ccgagcagct tgaaccggtc       180
     aagcagcagt acggcatcac tccgcaactg gcgtcctgcc acaccggggt ggtgaacggc       240
     tatgtggtgg aggggcatgt acccgccgcc gacgtgcaga agctgctcaa ggaaaaaccg       300
     gcgatccgcg gcctgaccat tccgggcatg ccccagagtg cgccaggcat ggatattccg       360
     ggtcagccct atcaggtgct gagcatcagc aacgagggcg cgaccaaggt ctggtcgagc       420
     taccccggct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page