(data stored in ACNUC7421 zone)

EMBL: CP000462.PE324

CP000462.PE324       Location/Qualifiers
FT   CDS_pept        363580..365799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0348"
FT                   /product="protease II"
FT                   /EC_number="3.4.21.83"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39710"
FT                   /db_xref="GOA:A0KF55"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF55"
FT                   /protein_id="ABK39710.1"
FT                   /translation="MIPCPRSQGSGPPTLLQRKGCDMFTFSRGLLLLACLAAVPCSYAN
FT                   DESAMPTSDTLIQPPVAAKHPHAIKKHGDTRVDNYYWLRDDERQKPEVLAYLEAENAYT
FT                   DAMLKPIKPLRDQLYQEMVARIPQQDESVPYVKNGYRYQTRYEPGKEYAIYSRSKLGEE
FT                   AASLLLDGNQRAEGHEFYALGALEVSRNNRWLAVAEDFLSRRQYQIQFLDLESGKWAAE
FT                   LLPNTSGNLVWANDSKTVFYVRKHPKTLLPYQVYRHELGTEPAKDQLVYEEKDDSFYVS
FT                   LYATTSEDFIVIALSSTTSGEARLIDANVPTQAPRLFLPRQVDHEYSLDHYRGRFYVRS
FT                   NKDGKNFGLYETKESPVDRWKAVIAPNPDVLLESYALFKEWLVLEERSQGLTRLRQVNW
FT                   QSGEQKEIAFDDPAYVTWLAYNPEPDTSALRYGYSSMTTPSSTYELDLNSGKRTLLKQQ
FT                   PVAGFKAEQYASERLWITARDGVAVPVSLVYRKDKFKQEGAGTHTNPLLVYGYGSYGAS
FT                   MDPDFSSARLSLLDRGFVYAIAHIRGGEELGRHWYEDGKLLKKQNTFNDFIDVTEALVA
FT                   QGYGAKDQVYAMGGSAGGLLMGAVINQAPQLYRGVVAQVPFVDVVTTMLDESIPLTTGE
FT                   YDEWGNPNQKRYYDYMKAYSPYDQVKAQAYPNLLVTTGLHDSQVQYWEPAKWVAKLREL
FT                   KTDDNKLLLSTDMDAGHGGKSGRFKAYEDIALEFAFILDLAKPQA"
     ttgatcccct gtccaaggag ccaaggctca ggtccgccaa cccttttaca gcgcaaagga        60
     tgcgacatgt tcaccttttc ccgagggctt ctgctgctgg cttgtctggc cgccgttccc       120
     tgttcatatg ccaatgatga gtccgccatg cccacaagcg acaccctgat ccagcctccc       180
     gtggccgcca aacaccctca cgccatcaag aaacacgggg atacccgggt cgacaactac       240
     tactggctgc gggatgacga gcgccagaaa cccgaggtgc tggcctacct cgaggctgaa       300
     aacgcctaca ccgacgccat gctcaaaccg atcaagccgc tgcgcgacca gctctatcag       360
     gagatggtgg cccgcattcc gcagcaggac gagtcggtgc cctacgtgaa gaacggctat       420
     cgctaccaga cccgctacga gccgggcaag gagtacgcca tctattcgcg cagcaagctg       480
     ggtgaagagg ctgcgagcct gctgctggac ggcaaccagc gcgccgaagg ccacgagttc       540
     tacgccctgg gggcgctcga ggtgagccgc aacaaccgct ggctggcggt ggcggaagat       600
     ttcctctccc gccgtcagta ccagatccag ttcctcgacc tggagagcgg caaatgggcc       660
     gccgagttgc ttccgaacac ctccggcaac ctggtctggg ccaacgacag caagacggtg       720
     ttctacgtgc gcaagcaccc caagacgctg ctgccctacc aggtctatcg ccacgagctg       780
     ggcacggagc cggccaagga tcagctggtc tatgaggaga aggacgactc cttctatgtg       840
     agcctctacg ccaccacctc ggaagatttc atcgtcatcg ccctctccag caccacctcg       900
     ggcgaggcgc gtctcatcga tgccaacgta ccgacccagg cgccgcggct gttcctgccg       960
     cgccaggtgg atcacgaata cagcctggat cactaccgcg gccgcttcta tgtgcgctcc      1020
     aacaaggacg gcaagaactt cggcctctac gagaccaagg agagcccggt ggatcgctgg      1080
     aaggcggtga tcgcccccaa tccggacgtg ctgctggaga gctatgccct gttcaaggag      1140
     tggctggtgc tggaggagcg cagtcagggg ctgacccggc tgcggcaggt caactggcag      1200
     agcggcgagc agaaggagat cgccttcgac gatccggcct atgtcacctg gctcgcctac      1260
     aacccggagc cggataccag cgcgctgcgc tatggctact cctccatgac caccccctcg      1320
     tccacctacg agctcgacct gaacagcggc aagcgcaccc tgctcaagca gcagccggtg      1380
     gcgggcttca aggccgagca atatgccagc gagcggctct ggatcaccgc ccgtgacggc      1440
     gtggccgtgc cggtgtcgct ggtctatcgc aaggacaagt tcaagcaaga gggggcgggg      1500
     acgcatacca atccgctgct ggtctacggc tacggctcct atggcgccag catggacccg      1560
     gatttcagca gcgccaggct gagcctgctg gaccgcggct tcgtctacgc catcgcccac      1620
     atccgtggtg gcgaggagct gggccgccac tggtatgaag atggcaagct gctgaaaaag      1680
     cagaatacct tcaacgactt catcgacgtg accgaggcgc tggtggcgca gggctacggc      1740
     gccaaggatc aggtctacgc catgggcggc agcgccggcg gtctgctgat gggggccgtc      1800
     atcaatcagg cgccccagct ctatcgcggc gtggtggccc aggtgccgtt cgtcgatgtg      1860
     gtcaccacca tgctggacga gtccattccc ctcaccaccg gggagtacga cgagtggggc      1920
     aacccgaacc agaagcgcta ctacgactac atgaaggcct acagccccta cgatcaggtc      1980
     aaggcgcagg cctatcccaa cctgctggtg accaccggct tgcacgattc ccaggtgcag      2040
     tactgggagc cggccaagtg ggtggccaag ctgcgcgagc tgaagacgga tgataacaag      2100
     ttgttgctga gcaccgacat ggacgccggc cacggcggca agtcgggtcg cttcaaagcc      2160
     tacgaggata tcgcgctgga gttcgcgttt attctggatc tggccaagcc acaagcataa      2220
//

If you have problems or comments...

PBIL Back to PBIL home page