(data stored in ACNUC7421 zone)

EMBL: CP000462.PE325

CP000462.PE325       Location/Qualifiers
FT   CDS_pept        366071..367186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0349"
FT                   /product="trap transporter solute receptor, taxi family"
FT                   /note="identified by match to protein family HMM TIGR02122"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38189"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF56"
FT                   /protein_id="ABK38189.1"
FT                   /translation="MLVAFWGTFAVHPLPHIEVMGNRRRRTVVCPAFARGTGELNQSKR
FT                   MNNMKGLSLACALSAVLAGVSFGGPVQAQERFVTIGTGGQTGVYYVAGQSICRFLNRGA
FT                   ADHQIKCNAPASGGGVANVNGIRSGEFNFGIMQSDHQYKAMKGLPPFQAEGAMDDMRAV
FT                   FSLQSEVFTILARKDAKIAGFDDLKGKRVNIGNPGSGQRDTFEEIMAVKGWKKGDFGLV
FT                   SELKPAEQASALGDNNIDAMSYFVGHPNGAIQEASTTTDAVLVPVTGADIDKLLAEKSY
FT                   YSKAEIPGGIYKGSDQPTPSIGGKAVLSTSAKADPEVVYQLVKSVFDNLDRFKRLHPAF
FT                   ADLKEADMIKVGLSAPLHEGAARYYKERGWL"
     atgctggtgg ctttttgggg aacgttcgcc gttcacccgc ttcctcatat cgaggtcatg        60
     ggcaaccgcc gacgcagaac ggtggtttgt ccggcattcg cccgtggaac gggcgagctg       120
     aatcaatcaa aaaggatgaa caacatgaaa ggattatccc tggcgtgtgc cctgtcggct       180
     gtcctggccg gcgtctcgtt cggtggtccg gtgcaggcgc aggagcgctt cgtgaccata       240
     ggcaccggcg gtcagaccgg tgtctactac gtggcgggcc agtccatctg ccgcttcctc       300
     aatcgcggcg ccgccgatca ccagatcaag tgcaacgccc cggccagcgg tggcggggta       360
     gccaacgtca acggcatccg cagcggtgaa ttcaacttcg gcatcatgca gtccgaccat       420
     cagtacaagg cgatgaaggg gctgccgccg ttccaggccg agggtgccat ggacgacatg       480
     cgcgccgtct tctccctgca gagcgaggtg ttcaccatcc tggcccgcaa ggacgccaag       540
     atcgccggct tcgacgatct caagggcaag cgggtcaaca tcggcaaccc gggttccggc       600
     cagcgcgaca ccttcgaaga gatcatggcg gtgaaggggt ggaaaaaggg cgacttcggc       660
     ctggtctccg agctcaagcc ggccgagcag gcctcggcat tgggtgacaa caacatcgac       720
     gccatgagct acttcgtcgg ccaccccaac ggcgccatcc aggaagcctc caccaccacc       780
     gacgccgtgc tggtaccggt caccggcgcc gacatcgaca agctgctggc cgagaagagc       840
     tactacagca aggccgagat cccgggcggc atctacaagg gcagcgacca gccgaccccg       900
     tccattggcg gcaaggcggt gctctccacc agtgccaagg cggatccgga agtggtctat       960
     caactggtga agtcggtatt cgacaacctg gatcgtttca agcgcctgca cccggccttc      1020
     gccgacctga aagaggccga catgatcaag gtgggtctct ccgccccgct gcatgaaggg      1080
     gctgcccgct actacaaaga gcgcggctgg ctctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page