(data stored in ACNUC7421 zone)

EMBL: CP000462.PE326

CP000462.PE326       Location/Qualifiers
FT   CDS_pept        367289..369841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0350"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR02123"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35902"
FT                   /db_xref="GOA:A0KF57"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF57"
FT                   /protein_id="ABK35902.1"
FT                   /translation="MQDKQLSTEELIAQDVGARLPLGIMGGCITTLALAWSLFQLWIAS
FT                   PLPFMLGFGVLNDTETRAIHLTFALLLAYLVFPAFRRSPRDRVPLGDLALGLVAAGAAS
FT                   YLFVMYEALAQRPGNLTTADLVTACIGIPLLLEAARRALGPALAVIALVFLAYSLAGPW
FT                   MPGLLAHRGVSFTALANHQWITTEGVFGIALGVSTSFVFLFVLFGALLERAGAGHYFIQ
FT                   LAFSLLGHLRGGPAKAAVVASGLTGLISGSSIANVVTTGTFTIPMMKKVGFSAEKAGAV
FT                   EVASSVNGQIMPPVMGAAAFLMVEYVGIPYVEIIKHAFLPATISYIALLYIVHLEALKL
FT                   GMQPIGDHQPKPWLRRLTGFAFGAALISGLSMAVYYGLGWLKPALGDYALPGIALLLAA
FT                   TYLGLLKIAASNEPLAAEDPDKPLTELPNTRTVLLSGLHFLLPVVVLVWCLMVERLSPG
FT                   LSAFWGTVMLVIILLTQRPLLNWLRSDGRHDYGSLQDGLIDLREGLVAGARNMIGIGIA
FT                   TATAGIIVGAVSQTGVGLVLADLVEMLSMGNLLLMLLLTALLSLILGMGLPTTANYIVV
FT                   SSLLAPVVVTLGQQNGLIVPLIAVHLFVFYFGIMADVTPPVGLASFAAAAVSKGDPIKT
FT                   GITAFYYSLRTAALPFLFIFNTDLLLIDVDFAHGVLIFMVATVAMLIFAAATQGHFLVK
FT                   SRWYESVLLLLVAFTLFRPGFWMDMVHDPYRETPPAQLAQTLGEVEAESTLRLRIQGED
FT                   AVGKLRQSTVLLAVPAGEDGEARLASLGLALYEQDGKTLIDSVTFGSPAAAAGMEFDQE
FT                   IMMVKAPTERWRKELMWLPGFLLFALIVWLQRRRVVRA"
     atgcaagata aacaactctc taccgaggaa ctgatcgccc aggatgtggg ggcgcgtctg        60
     ccgctcggca tcatgggtgg gtgcatcacc accctggcgc tcgcctggtc gctgttccag       120
     ctctggatcg cctcgccgct gcccttcatg ctgggcttcg gcgtgctcaa tgacaccgag       180
     acccgtgcca ttcacctcac cttcgccctg ctgctggcct atctggtgtt cccggccttt       240
     cgccgctcgc cgcgcgaccg ggtgccgctc ggcgatctgg cgctcgggct ggtggccgcc       300
     ggtgccgctt cctatctgtt cgtgatgtac gaggcgctgg cccagcggcc gggcaacctc       360
     accaccgccg atctggtgac cgcctgcatc ggcattccgc tgctgctgga agccgcccgc       420
     cgtgcgctgg ggccggccct ggcggtgatc gccctggtat ttctcgccta cagcctggcg       480
     gggccctgga tgccgggcct gctggctcac cgcggggtga gcttcaccgc gctggccaac       540
     caccagtgga tcaccaccga gggggtgttc ggcatcgccc tcggcgtctc caccagcttc       600
     gtgttcctgt tcgtgctgtt cggtgccctg ctggagcggg ccggtgccgg ccactacttc       660
     atccagctcg ccttcagcct gctcggtcac ctgcgcggcg gcccggccaa ggcggcggtg       720
     gtggcctccg gcctgaccgg ccttatctcc ggctcctcca tcgccaacgt ggtgaccacc       780
     ggcaccttta ccattcccat gatgaagaag gtggggttca gcgccgagaa ggcgggggcg       840
     gtggaagtgg cctcctcggt caacggccag atcatgccgc cggtgatggg ggccgcggcc       900
     tttctgatgg tggagtacgt gggcattccc tacgtcgaga tcatcaagca cgccttcctg       960
     ccggcgacca tctcctacat agcgctgctc tacatcgtcc atctggaggc gctcaagctc      1020
     ggcatgcagc ccatcggcga ccatcagccc aagccctggc tgcgccggtt gaccggcttt      1080
     gcctttggcg ccgccctgat cagcgggctg tcgatggcgg tctactacgg ccttggttgg      1140
     ctcaagccgg cgctgggcga ctatgccctg cccggcatcg ccctgctgct ggccgccacc      1200
     tatctggggc tgttgaaaat tgccgccagc aatgagccgc tggcggcgga agatccggac      1260
     aagccgctga ccgagctgcc caacacccgt accgtgctgc tctccggcct gcacttcctg      1320
     ctgccggtgg tggtgctggt gtggtgcctg atggtggagc ggctctcgcc cgggctgtcg      1380
     gccttctggg gcaccgtcat gctggtgatc atactgctga cccagcggcc gctgctcaac      1440
     tggctgcgca gcgatggccg gcacgattac ggctccctgc aggacggctt gatcgatctg      1500
     cgagaggggc tggtggccgg tgcccgcaac atgatcggca tcggcatcgc caccgccacg      1560
     gcggggatca tcgtcggtgc cgtctcccag accggggttg gtctggtgct ggcggatctg      1620
     gtggagatgc tctccatggg caacctgctg ctgatgctgc tgctgaccgc cttgctgagc      1680
     ctcatcctcg gcatggggct gcccaccacc gccaactaca tagtggtctc cagcctgctg      1740
     gcgccggtgg tggtgacgct cgggcagcag aacgggctga tcgtgccgct catcgcggtg      1800
     cacctgttcg tgttctactt cggcatcatg gccgacgtga cgccgccggt ggggctcgcc      1860
     tcgttcgcgg cggcggccgt ctccaagggc gatcccatca agaccggcat caccgccttt      1920
     tactacagcc tgcgcaccgc cgcgctgccg ttcctgttca tcttcaacac cgacctgctg      1980
     ctgatcgacg tggactttgc ccacggggtg ctgatcttca tggtggccac cgttgccatg      2040
     ctgatcttcg ccgccgccac ccagggtcat tttctggtga agagtcgctg gtacgaaagc      2100
     gtgctgctgt tgctggtggc cttcaccctg ttccgccccg gtttctggat ggacatggtg      2160
     cacgatccct atcgcgagac gccgccggcc cagctggccc agaccctggg cgaggtggag      2220
     gcggagagca ctctgcggct gcggatccag ggtgaggatg cggtgggcaa gctgcgtcag      2280
     tcgaccgtgc tgctggcggt gccggcaggg gaggatgggg aagcccgcct cgccagcctg      2340
     gggctcgcgc tctatgagca ggatggcaag accttgatcg acagcgtcac cttcggcagt      2400
     ccggcggcgg cagccggcat ggagtttgac caggagatca tgatggtcaa ggcgcccacc      2460
     gagcgctggc gcaaggagct gatgtggctg cccggtttcc tgctgtttgc gctaatcgtc      2520
     tggctgcaaa ggcgcagggt ggtgcgagca taa                                   2553
//

If you have problems or comments...

PBIL Back to PBIL home page