(data stored in ACNUC7421 zone)

EMBL: CP000462.PE327

CP000462.PE327       Location/Qualifiers
FT   CDS_pept        complement(369900..370010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36703"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF58"
FT                   /protein_id="ABK36703.1"
FT                   /translation="MMCHLGISFEQACEQLGLSQVEQQTLSLLQEQDPQE"
     atgatgtgcc accttggcat cagcttcgag caagcctgtg aacagctggg cctgagccag        60
     gtggagcaac agaccctgag cctgctgcag gagcaggatc cgcaggaata a                111
//

If you have problems or comments...

PBIL Back to PBIL home page