(data stored in ACNUC7421 zone)

EMBL: CP000462.PE33

CP000462.PE33        Location/Qualifiers
FT   CDS_pept        complement(40508..41173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0037"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38526"
FT                   /db_xref="GOA:A0KR24"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR24"
FT                   /protein_id="ABK38526.1"
FT                   /translation="MENPFGSWLESQVIRDHLTNPNIEAGEYSYYSGYYHGKPFEDHCV
FT                   RYLLGDGSMRESWDSGQWGKEVDRLIIGKFCSIASGATFMLAGNQGHRLDWVSTFPFDA
FT                   ARFGDGVQDGFLRKGDTRIGNDVWIGSEAMIMPGITIGDGAVIATRAVVTKNVAPYTIV
FT                   GGNPAQPIRRRFGEEQIAMLQEMQWWDWPLQHLQAAMPLLCSGDIQALYRHWQQECTS"
     atggaaaatc cgttcggtag ctggctggaa tcccaggtca tacgggatca tctgaccaac        60
     cccaatatcg aggccgggga gtacagctat tactccggct actaccacgg caagccgttc       120
     gaggatcatt gcgtacgcta cctgctcggc gatggttcga tgcgggagtc ctgggacagt       180
     ggccagtggg gtaaggaagt tgaccgcctg atcatcggca agttctgctc catcgcctcc       240
     ggcgccacct tcatgctggc gggcaaccaa ggtcaccggc tggactgggt ttccaccttc       300
     cccttcgatg ctgcccgctt cggtgacggc gtgcaggacg gttttctgcg caagggagac       360
     acccggatcg gcaacgacgt ctggatcggc tcggaagcga tgatcatgcc cggcatcacc       420
     atcggtgatg gtgccgtcat cgccactcgt gccgtggtga ccaagaatgt ggccccttac       480
     accatagtcg gcggcaaccc ggcccagcct atccgacgtc gcttcggcga ggagcagatt       540
     gccatgctgc aggagatgca gtggtgggac tggccgctgc agcacctgca ggcggctatg       600
     ccgctactct gttcgggcga tattcaggcc ctttaccgac actggcagca ggagtgcaca       660
     tcatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page